Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2T2K2

Protein Details
Accession A0A0C2T2K2    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRMTKHESSLKTLKQKKKDQNFPTRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
85-111RPKKTRAIRRRMTKHESSLKTLKQKKK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLHKQLADLKGELLQLRVQKIAGGSASKLTKINTVRKSIARVLTVMNQKARQNLREYYKNKKYLPLDLRPKKTRAIRRRMTKHESSLKTLKQKKKDQNFPTRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.55
4 0.6
5 0.57
6 0.55
7 0.54
8 0.57
9 0.56
10 0.49
11 0.43
12 0.35
13 0.3
14 0.27
15 0.24
16 0.17
17 0.16
18 0.16
19 0.17
20 0.17
21 0.15
22 0.14
23 0.14
24 0.14
25 0.12
26 0.1
27 0.1
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.26
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.42
59 0.44
60 0.48
61 0.54
62 0.59
63 0.56
64 0.58
65 0.54
66 0.54
67 0.58
68 0.58
69 0.6
70 0.62
71 0.7
72 0.68
73 0.67
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.85
83 0.84
84 0.81
85 0.79
86 0.79
87 0.73
88 0.7
89 0.68
90 0.66
91 0.68
92 0.71
93 0.71
94 0.7
95 0.77
96 0.8
97 0.83
98 0.87
99 0.87
100 0.89
101 0.91
102 0.87
103 0.86
104 0.82