Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WT56

Protein Details
Accession A0A0C2WT56    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-157EIDRTNLLKEREKRRKKLQKLGPPRPADDBasic
NLS Segment(s)
PositionSequence
137-153KEREKRRKKLQKLGPPR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, pero 4
Family & Domain DBs
Amino Acid Sequences MTDYASQGKTRRFNIVDLNNSRSHQAYYTALSRSASSMGTLILQGFDCKKITGGASGALRQEFRALELLDYITCLRYRGKLPACVGGDVRNDLIASFRAWKGEHFIPQGVHKSIRWSKSDPYIEDSIIEIDRTNLLKEREKRRKKLQKLGPPRPADDLAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.57
4 0.55
5 0.57
6 0.52
7 0.5
8 0.48
9 0.4
10 0.33
11 0.25
12 0.23
13 0.2
14 0.21
15 0.24
16 0.24
17 0.23
18 0.22
19 0.22
20 0.19
21 0.18
22 0.14
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.08
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.11
41 0.13
42 0.13
43 0.15
44 0.15
45 0.15
46 0.14
47 0.12
48 0.14
49 0.1
50 0.1
51 0.11
52 0.1
53 0.1
54 0.1
55 0.1
56 0.08
57 0.09
58 0.08
59 0.06
60 0.06
61 0.07
62 0.07
63 0.09
64 0.11
65 0.18
66 0.21
67 0.25
68 0.26
69 0.31
70 0.32
71 0.3
72 0.29
73 0.25
74 0.23
75 0.19
76 0.17
77 0.11
78 0.1
79 0.09
80 0.1
81 0.07
82 0.07
83 0.09
84 0.09
85 0.11
86 0.11
87 0.12
88 0.16
89 0.19
90 0.22
91 0.21
92 0.23
93 0.22
94 0.26
95 0.3
96 0.26
97 0.25
98 0.22
99 0.28
100 0.33
101 0.36
102 0.37
103 0.36
104 0.38
105 0.46
106 0.51
107 0.44
108 0.43
109 0.41
110 0.37
111 0.34
112 0.31
113 0.23
114 0.18
115 0.16
116 0.11
117 0.09
118 0.12
119 0.12
120 0.13
121 0.16
122 0.2
123 0.29
124 0.37
125 0.48
126 0.56
127 0.66
128 0.73
129 0.8
130 0.87
131 0.89
132 0.91
133 0.9
134 0.9
135 0.91
136 0.93
137 0.92
138 0.86
139 0.79
140 0.74