FuNGI

A0A0C2X215

Protein Details

Accession

A0A0C2X215

Localization Confidence

Low

Confidence Score

8.3

NoLS Segment(s)

Position	Sequence	Protein Nature
2-26	SPNSLSPSSRSPPRRQNRSDFDLEP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 9, mito 8, pero 3, golg 3, cyto 2, extr 2

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR046347 bZIP_sf IPR021755 TF_Aft1_HRA IPR020956 TF_Aft1_OSM
Gene Ontology	GO:0003700 F:DNA-binding transcription factor activity
Pfam	View protein in Pfam PF11786 Aft1_HRA PF11785 Aft1_OSA PF00170 bZIP_1
PROSITE	View protein in PROSITE PS50217 BZIP
CDD	cd14687 bZIP_ATF2

Amino Acid Sequences

MSPNSLSPSSRSPPRRQNRSDFDLEPNPFEQSFAPSRSASSNVRNSSPQRDSIGPSSSNDSVPNEDDTPRSRDDSSRSSAPNQRSSPRPVLPPLSSISSPSDPAAYAWYTNNSIQNSLRAGPLSPAMLTAPQTNNEQPPMPFDPSSFRTGLTPRTGLTPRTGLTPGGGLTPLAASSVGFPPSPGTAAFLALMNNGATAAPSTQTITPNTLNAISGVLASTPPDALNSTYASASSAASTAANGLFLLSQAHQELTKREEQARAGNATSNGLNGSLVTHNNKRGTKRKSVDTLSPPPPPPPPLTSTTQARTGGNRTRAMAGVNGKGRKASPRSEEFDDDDDDGRDEDDFEERFQAETSNTGGRRSKKPETEEEKRRNFLERNRQAALKCRQRKKAWLAQLQAKVEYLSNENERLTSALVSSREEISRLSALVGGAGVVGAVPIGVGVNGVSIGGPGVQPVSMNVSLPGKGSGNSATVTTVGVGQTGRNNSGYGY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.73
2	0.8
3	0.81
4	0.85
5	0.85
6	0.84
7	0.82
8	0.74
9	0.71
10	0.69
11	0.63
12	0.56
13	0.48
14	0.43
15	0.36
16	0.34
17	0.27
18	0.24
19	0.27
20	0.26
21	0.29
22	0.26
23	0.28
24	0.29
25	0.34
26	0.32
27	0.36
28	0.42
29	0.42
30	0.45
31	0.5
32	0.52
33	0.56
34	0.55
35	0.5
36	0.46
37	0.45
38	0.47
39	0.45
40	0.46
41	0.39
42	0.36
43	0.38
44	0.35
45	0.33
46	0.3
47	0.27
48	0.25
49	0.25
50	0.27
51	0.24
52	0.24
53	0.26
54	0.28
55	0.3
56	0.29
57	0.3
58	0.29
59	0.31
60	0.36
61	0.39
62	0.41
63	0.43
64	0.44
65	0.48
66	0.53
67	0.55
68	0.58
69	0.57
70	0.56
71	0.56
72	0.6
73	0.61
74	0.58
75	0.57
76	0.53
77	0.54
78	0.5
79	0.46
80	0.42
81	0.38
82	0.33
83	0.3
84	0.3
85	0.25
86	0.25
87	0.23
88	0.21
89	0.16
90	0.16
91	0.17
92	0.13
93	0.13
94	0.13
95	0.16
96	0.18
97	0.2
98	0.25
99	0.22
100	0.24
101	0.24
102	0.25
103	0.25
104	0.23
105	0.22
106	0.18
107	0.17
108	0.15
109	0.16
110	0.14
111	0.11
112	0.1
113	0.1
114	0.1
115	0.11
116	0.14
117	0.14
118	0.16
119	0.19
120	0.21
121	0.23
122	0.24
123	0.25
124	0.2
125	0.25
126	0.27
127	0.27
128	0.25
129	0.24
130	0.28
131	0.29
132	0.33
133	0.27
134	0.23
135	0.22
136	0.24
137	0.28
138	0.26
139	0.24
140	0.2
141	0.25
142	0.27
143	0.25
144	0.26
145	0.24
146	0.21
147	0.23
148	0.24
149	0.18
150	0.16
151	0.16
152	0.14
153	0.11
154	0.11
155	0.07
156	0.07
157	0.06
158	0.06
159	0.05
160	0.05
161	0.04
162	0.06
163	0.08
164	0.09
165	0.08
166	0.09
167	0.09
168	0.1
169	0.11
170	0.09
171	0.09
172	0.08
173	0.09
174	0.09
175	0.09
176	0.08
177	0.08
178	0.08
179	0.06
180	0.05
181	0.05
182	0.04
183	0.04
184	0.04
185	0.04
186	0.04
187	0.05
188	0.06
189	0.08
190	0.1
191	0.11
192	0.14
193	0.15
194	0.15
195	0.15
196	0.14
197	0.12
198	0.11
199	0.1
200	0.06
201	0.06
202	0.05
203	0.04
204	0.04
205	0.04
206	0.04
207	0.04
208	0.04
209	0.05
210	0.05
211	0.06
212	0.07
213	0.08
214	0.08
215	0.08
216	0.08
217	0.08
218	0.08
219	0.08
220	0.06
221	0.06
222	0.05
223	0.05
224	0.05
225	0.05
226	0.04
227	0.04
228	0.04
229	0.04
230	0.03
231	0.04
232	0.05
233	0.04
234	0.05
235	0.05
236	0.06
237	0.06
238	0.07
239	0.09
240	0.11
241	0.15
242	0.16
243	0.18
244	0.2
245	0.21
246	0.25
247	0.26
248	0.24
249	0.21
250	0.21
251	0.19
252	0.18
253	0.16
254	0.12
255	0.09
256	0.08
257	0.07
258	0.05
259	0.06
260	0.07
261	0.08
262	0.12
263	0.15
264	0.19
265	0.25
266	0.28
267	0.33
268	0.41
269	0.46
270	0.52
271	0.54
272	0.57
273	0.58
274	0.59
275	0.6
276	0.58
277	0.6
278	0.55
279	0.55
280	0.49
281	0.44
282	0.43
283	0.38
284	0.33
285	0.29
286	0.28
287	0.27
288	0.3
289	0.33
290	0.35
291	0.34
292	0.36
293	0.35
294	0.32
295	0.3
296	0.32
297	0.35
298	0.35
299	0.35
300	0.31
301	0.31
302	0.31
303	0.29
304	0.26
305	0.23
306	0.22
307	0.26
308	0.26
309	0.25
310	0.25
311	0.25
312	0.29
313	0.3
314	0.31
315	0.33
316	0.38
317	0.43
318	0.46
319	0.49
320	0.44
321	0.42
322	0.38
323	0.32
324	0.27
325	0.22
326	0.18
327	0.15
328	0.12
329	0.1
330	0.08
331	0.07
332	0.09
333	0.09
334	0.1
335	0.11
336	0.12
337	0.12
338	0.12
339	0.12
340	0.1
341	0.1
342	0.13
343	0.17
344	0.17
345	0.21
346	0.26
347	0.3
348	0.38
349	0.44
350	0.5
351	0.52
352	0.57
353	0.64
354	0.68
355	0.72
356	0.75
357	0.78
358	0.76
359	0.72
360	0.68
361	0.65
362	0.62
363	0.61
364	0.62
365	0.6
366	0.59
367	0.59
368	0.61
369	0.55
370	0.58
371	0.59
372	0.58
373	0.6
374	0.62
375	0.69
376	0.72
377	0.8
378	0.79
379	0.79
380	0.79
381	0.77
382	0.75
383	0.74
384	0.75
385	0.67
386	0.59
387	0.5
388	0.4
389	0.32
390	0.27
391	0.21
392	0.19
393	0.2
394	0.21
395	0.21
396	0.2
397	0.2
398	0.19
399	0.17
400	0.13
401	0.11
402	0.13
403	0.14
404	0.16
405	0.18
406	0.19
407	0.19
408	0.19
409	0.19
410	0.18
411	0.18
412	0.16
413	0.15
414	0.14
415	0.13
416	0.12
417	0.12
418	0.08
419	0.06
420	0.05
421	0.05
422	0.03
423	0.03
424	0.02
425	0.02
426	0.02
427	0.02
428	0.02
429	0.02
430	0.03
431	0.03
432	0.03
433	0.03
434	0.03
435	0.03
436	0.03
437	0.04
438	0.04
439	0.04
440	0.05
441	0.05
442	0.06
443	0.06
444	0.07
445	0.13
446	0.13
447	0.13
448	0.15
449	0.17
450	0.18
451	0.19
452	0.2
453	0.15
454	0.16
455	0.17
456	0.17
457	0.17
458	0.17
459	0.17
460	0.15
461	0.14
462	0.14
463	0.12
464	0.12
465	0.1
466	0.11
467	0.1
468	0.12
469	0.17
470	0.21
471	0.23
472	0.22

A0A0C2X215

3D AlphaFold-predicted Structure Viewer