Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WK95

Protein Details
Accession A0A0C2WK95    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
149-171VSILKDLIKKKKSRRLDHVDASDHydrophilic
NLS Segment(s)
PositionSequence
157-161KKKKS
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 6.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MSELSINCFVLGGDSSEVFTVEIPKTKNVSILKRRIKEEQSHRLNHVDASELIAWKVSLPVDIITPELTVDDIETCQKAQLHSVKKVSSIFGETLVDEHVHILVQVPTVNQPVAAPDPTQFLSLNCFVLRVDEKPNQIFTVEIPKTKNVSILKDLIKKKKSRRLDHVDASDLILSQVTRSPYPWVITLKKVSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.1
6 0.09
7 0.11
8 0.12
9 0.16
10 0.18
11 0.22
12 0.24
13 0.25
14 0.31
15 0.34
16 0.42
17 0.48
18 0.56
19 0.62
20 0.65
21 0.69
22 0.7
23 0.7
24 0.7
25 0.7
26 0.7
27 0.69
28 0.67
29 0.66
30 0.61
31 0.55
32 0.46
33 0.37
34 0.29
35 0.2
36 0.2
37 0.18
38 0.15
39 0.15
40 0.13
41 0.13
42 0.1
43 0.11
44 0.07
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.13
67 0.2
68 0.25
69 0.29
70 0.33
71 0.32
72 0.33
73 0.33
74 0.29
75 0.23
76 0.19
77 0.15
78 0.12
79 0.12
80 0.1
81 0.09
82 0.09
83 0.08
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.05
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.08
96 0.08
97 0.07
98 0.06
99 0.08
100 0.09
101 0.1
102 0.09
103 0.09
104 0.11
105 0.12
106 0.13
107 0.12
108 0.1
109 0.13
110 0.14
111 0.15
112 0.12
113 0.12
114 0.1
115 0.13
116 0.15
117 0.13
118 0.18
119 0.21
120 0.25
121 0.26
122 0.28
123 0.25
124 0.24
125 0.22
126 0.17
127 0.23
128 0.21
129 0.22
130 0.23
131 0.26
132 0.28
133 0.29
134 0.34
135 0.27
136 0.3
137 0.32
138 0.36
139 0.39
140 0.45
141 0.52
142 0.55
143 0.6
144 0.63
145 0.69
146 0.73
147 0.77
148 0.78
149 0.81
150 0.82
151 0.84
152 0.84
153 0.79
154 0.73
155 0.63
156 0.55
157 0.45
158 0.35
159 0.25
160 0.17
161 0.12
162 0.09
163 0.12
164 0.13
165 0.14
166 0.15
167 0.2
168 0.23
169 0.25
170 0.29
171 0.33
172 0.34
173 0.4
174 0.48