Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XJU9

Protein Details
Accession A0A0C2XJU9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
186-207VTTRERKTTKAGRQRKLSLKRSHydrophilic
NLS Segment(s)
PositionSequence
192-206KTTKAGRQRKLSLKR
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031327  MCM  
IPR008047  MCM_4  
IPR033762  MCM_OB  
IPR012340  NA-bd_OB-fold  
Gene Ontology GO:0042555  C:MCM complex  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003678  F:DNA helicase activity  
GO:0016787  F:hydrolase activity  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF17207  MCM_OB  
Amino Acid Sequences MGRVYKVRPFGLPPVNMRELNPSDTDKLTCIKGLVIRATPVIPDMKVAFFKCLTCSHTAQVEIDRGKIEEPARCPRDVCGSVGTMSLIHNRCEFADRQVIRLQETPDVVPDGQTPHTVSLRHIYDELVGQVSPNPVNRDHLVISNYWDPRSVPVRANPRQRTSKGLFKKVRDHLVETFFPVWEESVTTRERKTTKAGRQRKLSLKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.49
4 0.46
5 0.45
6 0.4
7 0.39
8 0.37
9 0.33
10 0.31
11 0.32
12 0.32
13 0.26
14 0.25
15 0.23
16 0.21
17 0.18
18 0.17
19 0.18
20 0.21
21 0.23
22 0.21
23 0.21
24 0.21
25 0.21
26 0.19
27 0.18
28 0.16
29 0.12
30 0.13
31 0.13
32 0.14
33 0.17
34 0.18
35 0.19
36 0.18
37 0.19
38 0.2
39 0.21
40 0.22
41 0.23
42 0.25
43 0.24
44 0.26
45 0.26
46 0.24
47 0.24
48 0.26
49 0.22
50 0.2
51 0.19
52 0.17
53 0.16
54 0.19
55 0.18
56 0.17
57 0.21
58 0.3
59 0.32
60 0.32
61 0.32
62 0.3
63 0.36
64 0.33
65 0.3
66 0.22
67 0.2
68 0.2
69 0.2
70 0.18
71 0.11
72 0.1
73 0.15
74 0.14
75 0.14
76 0.14
77 0.14
78 0.14
79 0.17
80 0.17
81 0.14
82 0.21
83 0.2
84 0.22
85 0.24
86 0.25
87 0.24
88 0.26
89 0.24
90 0.17
91 0.18
92 0.15
93 0.13
94 0.14
95 0.12
96 0.1
97 0.09
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.13
104 0.13
105 0.13
106 0.17
107 0.17
108 0.17
109 0.17
110 0.15
111 0.14
112 0.14
113 0.14
114 0.09
115 0.07
116 0.07
117 0.08
118 0.09
119 0.09
120 0.11
121 0.13
122 0.13
123 0.17
124 0.18
125 0.19
126 0.19
127 0.21
128 0.2
129 0.18
130 0.21
131 0.23
132 0.24
133 0.21
134 0.21
135 0.18
136 0.22
137 0.25
138 0.25
139 0.22
140 0.28
141 0.38
142 0.45
143 0.55
144 0.58
145 0.62
146 0.67
147 0.65
148 0.67
149 0.62
150 0.65
151 0.63
152 0.67
153 0.67
154 0.64
155 0.72
156 0.71
157 0.74
158 0.67
159 0.63
160 0.58
161 0.57
162 0.52
163 0.46
164 0.4
165 0.31
166 0.28
167 0.23
168 0.18
169 0.13
170 0.14
171 0.11
172 0.14
173 0.18
174 0.2
175 0.21
176 0.28
177 0.3
178 0.31
179 0.39
180 0.45
181 0.53
182 0.61
183 0.7
184 0.72
185 0.79
186 0.86
187 0.87