Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2T1I6

Protein Details
Accession A0A0C2T1I6   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-58KTPVKRNRGRPPGSKNKDKKBasic
90-133GEEPPPKRGRGRPRKNPQPTESAEAQGSEAPPRKKRGRPKKTATBasic
NLS Segment(s)
PositionSequence
41-132PVKRNRGRPPGSKNKDKKPAAQSSPNAAASSSTVPRKRGRPPKPKTEDTGEEPPPKRGRGRPRKNPQPTESAEAQGSEAPPRKKRGRPKKTA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSPHDAPEDTGEPQSHEEQDGHQPSVDAADDPASTQAKTPVKRNRGRPPGSKNKDKKPAAQSSPNAAASSSTVPRKRGRPPKPKTEDTGEEPPPKRGRGRPRKNPQPTESAEAQGSEAPPRKKRGRPKKTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.23
4 0.22
5 0.2
6 0.2
7 0.29
8 0.3
9 0.28
10 0.25
11 0.24
12 0.22
13 0.23
14 0.21
15 0.12
16 0.08
17 0.09
18 0.09
19 0.09
20 0.12
21 0.11
22 0.11
23 0.11
24 0.18
25 0.23
26 0.25
27 0.34
28 0.4
29 0.49
30 0.56
31 0.65
32 0.68
33 0.72
34 0.76
35 0.76
36 0.77
37 0.78
38 0.79
39 0.8
40 0.77
41 0.76
42 0.8
43 0.74
44 0.72
45 0.69
46 0.7
47 0.65
48 0.65
49 0.57
50 0.52
51 0.53
52 0.46
53 0.37
54 0.28
55 0.23
56 0.16
57 0.17
58 0.15
59 0.16
60 0.18
61 0.21
62 0.26
63 0.31
64 0.39
65 0.48
66 0.56
67 0.61
68 0.67
69 0.74
70 0.78
71 0.78
72 0.73
73 0.69
74 0.64
75 0.59
76 0.6
77 0.54
78 0.54
79 0.51
80 0.53
81 0.5
82 0.48
83 0.47
84 0.47
85 0.53
86 0.56
87 0.66
88 0.7
89 0.78
90 0.86
91 0.91
92 0.92
93 0.85
94 0.82
95 0.76
96 0.71
97 0.62
98 0.54
99 0.44
100 0.35
101 0.32
102 0.25
103 0.22
104 0.22
105 0.26
106 0.3
107 0.36
108 0.44
109 0.52
110 0.59
111 0.69
112 0.74
113 0.78