Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X5Y9

Protein Details
Accession A0A0C2X5Y9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-72VSRTFLGSKRQSRPRRPRGLRSYQFHGHydrophilic
NLS Segment(s)
PositionSequence
57-63SRPRRPR
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MHSPRRLRRISITFCWHYSPWYSLSSHRAHEAAHTEAGSDVQELEVSRTFLGSKRQSRPRRPRGLRSYQFHGRLLTGSSNFLIFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.49
4 0.42
5 0.37
6 0.31
7 0.25
8 0.24
9 0.23
10 0.22
11 0.28
12 0.29
13 0.27
14 0.26
15 0.24
16 0.22
17 0.23
18 0.23
19 0.19
20 0.17
21 0.15
22 0.14
23 0.13
24 0.13
25 0.11
26 0.07
27 0.05
28 0.04
29 0.05
30 0.04
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.09
38 0.17
39 0.23
40 0.3
41 0.38
42 0.49
43 0.58
44 0.69
45 0.78
46 0.81
47 0.85
48 0.86
49 0.88
50 0.88
51 0.89
52 0.87
53 0.82
54 0.8
55 0.77
56 0.73
57 0.64
58 0.56
59 0.46
60 0.38
61 0.34
62 0.31
63 0.24
64 0.22
65 0.2