Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WTR1

Protein Details
Accession A0A0C2WTR1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-24SGEGSTNRKNRKKADVERKAVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKSGEGSTNRKNRKKADVERKAVVVVRLHDFSLHFTTTFPVLFVRFPAFQATSVGCWYFFVHIRSLFDVLSSSAHVRQRGHEDATWWARWEDALCWKVWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.81
4 0.81
5 0.8
6 0.76
7 0.7
8 0.62
9 0.53
10 0.45
11 0.36
12 0.28
13 0.25
14 0.23
15 0.22
16 0.21
17 0.19
18 0.2
19 0.2
20 0.17
21 0.14
22 0.13
23 0.14
24 0.14
25 0.14
26 0.1
27 0.08
28 0.08
29 0.08
30 0.09
31 0.11
32 0.1
33 0.1
34 0.12
35 0.12
36 0.12
37 0.13
38 0.12
39 0.1
40 0.11
41 0.1
42 0.08
43 0.08
44 0.08
45 0.09
46 0.11
47 0.12
48 0.13
49 0.15
50 0.16
51 0.17
52 0.17
53 0.15
54 0.13
55 0.12
56 0.1
57 0.1
58 0.1
59 0.1
60 0.14
61 0.17
62 0.2
63 0.2
64 0.24
65 0.3
66 0.33
67 0.35
68 0.32
69 0.31
70 0.36
71 0.4
72 0.38
73 0.32
74 0.28
75 0.24
76 0.24
77 0.24
78 0.2
79 0.24
80 0.24