Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2T3Z8

Protein Details
Accession A0A0C2T3Z8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-56LSREERPFRLKRKERLRNLSPBasic
NLS Segment(s)
PositionSequence
42-55PFRLKRKERLRNLS
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSSVFKGKSNKSKADPGQKSATAPPSITVEETPHELSREERPFRLKRKERLRNLSPIPPSHSRAASRGPSERGKSQEYLPVLGTVANPNVGDKNRSVEIKANPSNLPIDGWDLLIERLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.67
4 0.66
5 0.6
6 0.57
7 0.52
8 0.49
9 0.4
10 0.34
11 0.3
12 0.26
13 0.26
14 0.24
15 0.2
16 0.16
17 0.15
18 0.18
19 0.19
20 0.16
21 0.16
22 0.16
23 0.17
24 0.24
25 0.31
26 0.3
27 0.31
28 0.38
29 0.44
30 0.52
31 0.61
32 0.61
33 0.62
34 0.71
35 0.79
36 0.8
37 0.83
38 0.79
39 0.77
40 0.72
41 0.69
42 0.61
43 0.52
44 0.48
45 0.43
46 0.41
47 0.34
48 0.33
49 0.27
50 0.26
51 0.29
52 0.27
53 0.27
54 0.27
55 0.29
56 0.31
57 0.34
58 0.35
59 0.34
60 0.34
61 0.32
62 0.31
63 0.32
64 0.28
65 0.26
66 0.23
67 0.19
68 0.16
69 0.15
70 0.14
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.13
77 0.14
78 0.15
79 0.14
80 0.18
81 0.21
82 0.22
83 0.23
84 0.26
85 0.31
86 0.39
87 0.42
88 0.42
89 0.38
90 0.39
91 0.39
92 0.33
93 0.28
94 0.19
95 0.19
96 0.16
97 0.16
98 0.14
99 0.14
100 0.15