Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WKB6

Protein Details
Accession A0A0C2WKB6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-50LTETGKTKRKRCRCECIPWGSVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MASVLAVQLPGIVDVVRISISPVFGVGGLTETGKTKRKRCRCECIPWGSVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.07
19 0.1
20 0.18
21 0.24
22 0.32
23 0.42
24 0.52
25 0.63
26 0.7
27 0.78
28 0.79
29 0.84
30 0.85
31 0.83
32 0.76