Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VUK1

Protein Details
Accession B2VUK1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29MVLSYSPQHVRRRKRRATAGGGESHydrophilic
NLS Segment(s)
PositionSequence
17-21RRKRR
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MFDGCMVLSYSPQHVRRRKRRATAGGGESPEHAVAAQVAVGRLAVVWCAGRSVGVVDDGAGRRSSDVHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.56
3 0.66
4 0.75
5 0.79
6 0.81
7 0.85
8 0.84
9 0.84
10 0.81
11 0.76
12 0.7
13 0.62
14 0.52
15 0.43
16 0.34
17 0.25
18 0.17
19 0.11
20 0.06
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.11
45 0.13
46 0.14
47 0.14
48 0.13
49 0.13