Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2TN23

Protein Details
Accession A0A0C2TN23    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
5-29YSYTDFLPARSRKKRKGNGTAGTTSHydrophilic
NLS Segment(s)
PositionSequence
14-20RSRKKRK
Subcellular Location(s) nucl 10, plas 8, cyto 3, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MTGSYSYTDFLPARSRKKRKGNGTAGTTSPGAKLQNLRGELVQDEWFVQCRQMIDDSLSDLKVPSFTAVICLGLGSPSSSQNACVQLAFLLEICDYLLIERQKISLYDPVFTEEDLTLLQGLQLAVLPTNENGLYPVEEPTMVFMPHCDMELYENFLKANWKTDMKLLIIANQLSEYVVNNPLNRLLTMAPFLVQVVPLLQHYAFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.6
3 0.66
4 0.77
5 0.84
6 0.86
7 0.89
8 0.89
9 0.87
10 0.84
11 0.79
12 0.69
13 0.62
14 0.52
15 0.41
16 0.32
17 0.26
18 0.19
19 0.18
20 0.21
21 0.24
22 0.3
23 0.31
24 0.32
25 0.29
26 0.3
27 0.27
28 0.26
29 0.21
30 0.14
31 0.14
32 0.13
33 0.15
34 0.13
35 0.13
36 0.12
37 0.11
38 0.13
39 0.14
40 0.14
41 0.14
42 0.14
43 0.16
44 0.16
45 0.15
46 0.14
47 0.12
48 0.11
49 0.1
50 0.1
51 0.07
52 0.06
53 0.06
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.06
65 0.08
66 0.08
67 0.09
68 0.12
69 0.14
70 0.13
71 0.12
72 0.12
73 0.1
74 0.1
75 0.09
76 0.07
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.08
85 0.07
86 0.08
87 0.08
88 0.09
89 0.09
90 0.1
91 0.11
92 0.12
93 0.13
94 0.13
95 0.13
96 0.16
97 0.15
98 0.15
99 0.14
100 0.09
101 0.09
102 0.08
103 0.08
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.05
119 0.06
120 0.07
121 0.08
122 0.08
123 0.09
124 0.08
125 0.08
126 0.08
127 0.1
128 0.1
129 0.09
130 0.08
131 0.08
132 0.1
133 0.1
134 0.11
135 0.09
136 0.08
137 0.11
138 0.12
139 0.18
140 0.16
141 0.16
142 0.16
143 0.16
144 0.2
145 0.18
146 0.22
147 0.2
148 0.22
149 0.22
150 0.26
151 0.29
152 0.26
153 0.3
154 0.26
155 0.26
156 0.27
157 0.26
158 0.22
159 0.19
160 0.18
161 0.13
162 0.13
163 0.1
164 0.09
165 0.15
166 0.17
167 0.18
168 0.19
169 0.22
170 0.23
171 0.22
172 0.21
173 0.17
174 0.16
175 0.18
176 0.17
177 0.14
178 0.13
179 0.14
180 0.12
181 0.11
182 0.09
183 0.08
184 0.09
185 0.09
186 0.11