Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BRP9

Protein Details
Accession A0A0D2BRP9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-56IAGRARKSAKRQKKGPSPPKTPKTSSHydrophilic
NLS Segment(s)
PositionSequence
27-53VESGIAGRARKSAKRQKKGPSPPKTPK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRSTVIGRAKITTYDDLAAARNKRGAVESGIAGRARKSAKRQKKGPSPPKTPKTSSDAPSNPKETDKEMSGTRGLESYCSVLQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.2
5 0.24
6 0.21
7 0.21
8 0.21
9 0.2
10 0.2
11 0.21
12 0.2
13 0.17
14 0.17
15 0.16
16 0.15
17 0.17
18 0.17
19 0.15
20 0.14
21 0.15
22 0.16
23 0.19
24 0.27
25 0.36
26 0.46
27 0.54
28 0.62
29 0.67
30 0.75
31 0.83
32 0.84
33 0.82
34 0.82
35 0.83
36 0.84
37 0.81
38 0.73
39 0.66
40 0.63
41 0.6
42 0.54
43 0.53
44 0.51
45 0.5
46 0.52
47 0.52
48 0.46
49 0.42
50 0.41
51 0.35
52 0.34
53 0.31
54 0.29
55 0.27
56 0.29
57 0.28
58 0.27
59 0.23
60 0.21
61 0.19
62 0.17
63 0.17
64 0.18