Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VXR7

Protein Details
Accession B2VXR7   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-54HPLQQKTSHARKSCRHTFRRHYAQQHHDGNHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 4, extr 4, cyto 3, plas 2, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
Amino Acid Sequences MLSRKPSIWLFSSCANLTPLTCGHPLQQKTSHARKSCRHTFRRHYAQQHHDGNHDQQHRQHQHNSGSHDPEQELLRWPEAQKPHKTPTPYQILRCRRGDAYTKHRFYALVKLYHPDACHASPAIAQLPLHVRLERYRMLVTAHDILSDIEKRKAYDIWGHGWAGHHNTPAAAQHNDWDYDPRRWTTDPRSNATWEDWERWHYENDGGNHAADDDRTVQMSNFTFMALIFAFISIGGVVQGTRFSTFNNSAIERRDQIHREASMEYRRSKNATLSASGDRDERIRTFLEHRDSTIMGEQCYQRLLPPADACSPEQVRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.26
4 0.23
5 0.23
6 0.2
7 0.19
8 0.21
9 0.2
10 0.23
11 0.31
12 0.33
13 0.36
14 0.41
15 0.45
16 0.53
17 0.62
18 0.66
19 0.65
20 0.71
21 0.73
22 0.76
23 0.79
24 0.8
25 0.79
26 0.8
27 0.83
28 0.85
29 0.88
30 0.87
31 0.86
32 0.86
33 0.86
34 0.85
35 0.83
36 0.74
37 0.68
38 0.63
39 0.58
40 0.57
41 0.53
42 0.46
43 0.43
44 0.52
45 0.55
46 0.56
47 0.58
48 0.56
49 0.59
50 0.62
51 0.63
52 0.59
53 0.58
54 0.55
55 0.5
56 0.43
57 0.37
58 0.33
59 0.28
60 0.27
61 0.22
62 0.22
63 0.22
64 0.22
65 0.26
66 0.34
67 0.4
68 0.43
69 0.47
70 0.52
71 0.55
72 0.59
73 0.57
74 0.57
75 0.6
76 0.57
77 0.57
78 0.6
79 0.64
80 0.66
81 0.64
82 0.59
83 0.5
84 0.49
85 0.51
86 0.49
87 0.5
88 0.54
89 0.53
90 0.5
91 0.49
92 0.46
93 0.39
94 0.41
95 0.37
96 0.31
97 0.29
98 0.3
99 0.32
100 0.33
101 0.31
102 0.23
103 0.21
104 0.17
105 0.18
106 0.16
107 0.14
108 0.13
109 0.14
110 0.13
111 0.1
112 0.1
113 0.1
114 0.13
115 0.14
116 0.15
117 0.14
118 0.14
119 0.15
120 0.19
121 0.19
122 0.19
123 0.17
124 0.16
125 0.17
126 0.17
127 0.17
128 0.16
129 0.14
130 0.12
131 0.12
132 0.11
133 0.12
134 0.14
135 0.13
136 0.13
137 0.14
138 0.15
139 0.16
140 0.16
141 0.16
142 0.18
143 0.19
144 0.19
145 0.21
146 0.2
147 0.2
148 0.19
149 0.19
150 0.17
151 0.16
152 0.13
153 0.11
154 0.11
155 0.11
156 0.12
157 0.15
158 0.11
159 0.1
160 0.12
161 0.13
162 0.14
163 0.14
164 0.17
165 0.17
166 0.2
167 0.22
168 0.21
169 0.23
170 0.24
171 0.29
172 0.34
173 0.39
174 0.41
175 0.43
176 0.44
177 0.43
178 0.43
179 0.4
180 0.36
181 0.29
182 0.28
183 0.25
184 0.24
185 0.25
186 0.25
187 0.24
188 0.19
189 0.22
190 0.23
191 0.23
192 0.25
193 0.23
194 0.21
195 0.2
196 0.19
197 0.15
198 0.1
199 0.1
200 0.08
201 0.08
202 0.09
203 0.09
204 0.09
205 0.12
206 0.13
207 0.13
208 0.11
209 0.1
210 0.1
211 0.09
212 0.11
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.05
219 0.06
220 0.04
221 0.04
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.05
228 0.07
229 0.07
230 0.08
231 0.14
232 0.17
233 0.2
234 0.23
235 0.25
236 0.25
237 0.29
238 0.32
239 0.28
240 0.28
241 0.33
242 0.32
243 0.34
244 0.38
245 0.35
246 0.33
247 0.33
248 0.37
249 0.38
250 0.4
251 0.42
252 0.4
253 0.43
254 0.44
255 0.45
256 0.44
257 0.43
258 0.41
259 0.39
260 0.38
261 0.4
262 0.38
263 0.37
264 0.32
265 0.26
266 0.25
267 0.25
268 0.22
269 0.2
270 0.2
271 0.22
272 0.26
273 0.33
274 0.39
275 0.37
276 0.38
277 0.39
278 0.37
279 0.37
280 0.38
281 0.33
282 0.25
283 0.29
284 0.28
285 0.26
286 0.27
287 0.25
288 0.19
289 0.26
290 0.27
291 0.29
292 0.3
293 0.34
294 0.36
295 0.39
296 0.38
297 0.39
298 0.41