Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2CDS7

Protein Details
Accession A0A0D2CDS7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MEKSSPRCVRSRPRTTPRPLRPRWRGERSLPEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
Amino Acid Sequences MEKSSPRCVRSRPRTTPRPLRPRWRGERSLPEEMPQKMLQANGAGVLVLFAKRGCTGTCRGLGGDAGFLAALSKATPAWTYPPVLTSPIIPIPTWSLSTPPQSVFLLLTWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.9
4 0.9
5 0.9
6 0.88
7 0.88
8 0.88
9 0.88
10 0.88
11 0.86
12 0.82
13 0.78
14 0.8
15 0.76
16 0.75
17 0.65
18 0.59
19 0.55
20 0.49
21 0.46
22 0.35
23 0.29
24 0.21
25 0.21
26 0.18
27 0.13
28 0.12
29 0.08
30 0.08
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.05
40 0.06
41 0.06
42 0.08
43 0.11
44 0.14
45 0.16
46 0.15
47 0.15
48 0.15
49 0.15
50 0.12
51 0.09
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.05
63 0.05
64 0.06
65 0.1
66 0.12
67 0.14
68 0.14
69 0.15
70 0.16
71 0.18
72 0.17
73 0.14
74 0.16
75 0.17
76 0.18
77 0.17
78 0.17
79 0.19
80 0.2
81 0.21
82 0.18
83 0.18
84 0.21
85 0.26
86 0.27
87 0.25
88 0.26
89 0.25
90 0.25
91 0.23