Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Z3C1

Protein Details
Accession A0A0D1Z3C1    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
568-587SGTVTKKKPKIVQPGNVVRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.333, nucl 9, mito_nucl 6.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR004161  EFTu-like_2  
IPR031157  G_TR_CS  
IPR015033  HBS1-like_N  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR000795  T_Tr_GTP-bd_dom  
IPR009000  Transl_B-barrel_sf  
IPR009001  Transl_elong_EF1A/Init_IF2_C  
IPR004160  Transl_elong_EFTu/EF1A_C  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF00009  GTP_EFTU  
PF03144  GTP_EFTU_D2  
PF03143  GTP_EFTU_D3  
PF08938  HBS1_N  
PROSITE View protein in PROSITE  
PS00301  G_TR_1  
PS51722  G_TR_2  
CDD cd01883  EF1_alpha  
cd16267  HBS1-like_II  
Amino Acid Sequences MVTEFQSLSESAPVLEPKPPRSTSCSHRDNQIQPCSSTTVMSNRRVKSLALDEDDYDDYEDYEGDYGDDGGDNELSAEDKEQMQQGTNNVRAALGSAFPVTDNEIQEALWHYYYDVGKSVAYLKNKQKPTPVATKKQMNGSKKPSPDDVVTKAQTAKAATSATSKAKDTNRAKSALAGGMHELSIQDAPKIKSKNIDVLAEYQKNKRKNAANFVVIGHVDAGKSTLMGRLLFDLKAVDQRTLDKYRQEAERIGKGSFAFAWVLDQGSEERARGVTIDIATNKFETDRTCFTILDAPGHRDFVPNMIAGASQADFAVLVIDASTGNFESGLKGQTKEHALLVRSIGVQRIIVAVNKMDVAEWSEKRFDEIRQQMAAFLSSAGFQSKNVTFVPCSGLGGENILTRASDSRSFWYTGPTLVEELDKAEPSTHALDKPLRMIINDVFRGGVQNPLSVSGRLDAGTIQVGEQVVIMPSGEKAQIRSLEVDDEPQEWAVAGQNVVLNLTDIDPIHLKSGDVLCSPLSPIQNIGEFKAKILAFDHLTPMNVDVHKGRLHVPGRISQLVGVLDKSSGTVTKKKPKIVQPGNVVRVIVHLDQVVPLEPPSRIVLRANGETVGAGLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.22
3 0.26
4 0.29
5 0.37
6 0.4
7 0.41
8 0.45
9 0.51
10 0.53
11 0.59
12 0.62
13 0.57
14 0.62
15 0.66
16 0.68
17 0.71
18 0.72
19 0.66
20 0.58
21 0.58
22 0.54
23 0.46
24 0.39
25 0.32
26 0.33
27 0.36
28 0.44
29 0.5
30 0.48
31 0.51
32 0.51
33 0.48
34 0.45
35 0.46
36 0.44
37 0.4
38 0.4
39 0.37
40 0.39
41 0.39
42 0.33
43 0.26
44 0.19
45 0.14
46 0.13
47 0.12
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.1
67 0.12
68 0.14
69 0.15
70 0.17
71 0.19
72 0.24
73 0.29
74 0.32
75 0.31
76 0.28
77 0.27
78 0.25
79 0.24
80 0.19
81 0.12
82 0.1
83 0.09
84 0.09
85 0.09
86 0.1
87 0.12
88 0.15
89 0.15
90 0.16
91 0.16
92 0.15
93 0.16
94 0.19
95 0.18
96 0.14
97 0.13
98 0.12
99 0.17
100 0.18
101 0.18
102 0.16
103 0.14
104 0.14
105 0.14
106 0.2
107 0.2
108 0.24
109 0.32
110 0.4
111 0.48
112 0.54
113 0.56
114 0.58
115 0.6
116 0.62
117 0.65
118 0.65
119 0.66
120 0.69
121 0.74
122 0.69
123 0.71
124 0.72
125 0.68
126 0.68
127 0.67
128 0.66
129 0.63
130 0.63
131 0.57
132 0.53
133 0.5
134 0.47
135 0.44
136 0.44
137 0.4
138 0.39
139 0.36
140 0.33
141 0.31
142 0.26
143 0.22
144 0.17
145 0.16
146 0.15
147 0.17
148 0.2
149 0.21
150 0.23
151 0.23
152 0.27
153 0.3
154 0.4
155 0.43
156 0.48
157 0.49
158 0.49
159 0.48
160 0.44
161 0.43
162 0.36
163 0.3
164 0.22
165 0.18
166 0.16
167 0.16
168 0.13
169 0.11
170 0.08
171 0.09
172 0.08
173 0.08
174 0.13
175 0.14
176 0.21
177 0.23
178 0.23
179 0.28
180 0.3
181 0.36
182 0.34
183 0.35
184 0.3
185 0.34
186 0.4
187 0.4
188 0.4
189 0.39
190 0.43
191 0.46
192 0.47
193 0.48
194 0.49
195 0.51
196 0.58
197 0.58
198 0.54
199 0.5
200 0.48
201 0.43
202 0.34
203 0.27
204 0.18
205 0.11
206 0.08
207 0.07
208 0.07
209 0.05
210 0.05
211 0.05
212 0.07
213 0.07
214 0.08
215 0.08
216 0.1
217 0.12
218 0.11
219 0.11
220 0.1
221 0.09
222 0.14
223 0.15
224 0.13
225 0.12
226 0.16
227 0.21
228 0.25
229 0.27
230 0.24
231 0.25
232 0.29
233 0.31
234 0.31
235 0.3
236 0.3
237 0.34
238 0.33
239 0.31
240 0.28
241 0.25
242 0.23
243 0.18
244 0.15
245 0.09
246 0.07
247 0.08
248 0.07
249 0.07
250 0.06
251 0.06
252 0.05
253 0.07
254 0.08
255 0.07
256 0.07
257 0.07
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.09
264 0.1
265 0.11
266 0.12
267 0.12
268 0.11
269 0.1
270 0.1
271 0.1
272 0.13
273 0.15
274 0.18
275 0.19
276 0.19
277 0.19
278 0.24
279 0.22
280 0.22
281 0.2
282 0.2
283 0.19
284 0.2
285 0.2
286 0.15
287 0.15
288 0.12
289 0.13
290 0.09
291 0.09
292 0.08
293 0.07
294 0.07
295 0.07
296 0.05
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.03
304 0.03
305 0.02
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.03
313 0.04
314 0.04
315 0.06
316 0.08
317 0.09
318 0.1
319 0.1
320 0.13
321 0.15
322 0.15
323 0.16
324 0.17
325 0.16
326 0.17
327 0.17
328 0.15
329 0.14
330 0.13
331 0.12
332 0.09
333 0.08
334 0.07
335 0.08
336 0.07
337 0.07
338 0.08
339 0.07
340 0.07
341 0.07
342 0.07
343 0.06
344 0.05
345 0.08
346 0.13
347 0.13
348 0.15
349 0.17
350 0.17
351 0.19
352 0.21
353 0.19
354 0.24
355 0.28
356 0.29
357 0.29
358 0.29
359 0.27
360 0.26
361 0.25
362 0.15
363 0.11
364 0.07
365 0.06
366 0.07
367 0.07
368 0.07
369 0.06
370 0.1
371 0.11
372 0.13
373 0.13
374 0.14
375 0.13
376 0.14
377 0.18
378 0.14
379 0.14
380 0.12
381 0.12
382 0.11
383 0.11
384 0.11
385 0.08
386 0.08
387 0.08
388 0.07
389 0.07
390 0.08
391 0.1
392 0.12
393 0.13
394 0.16
395 0.19
396 0.21
397 0.21
398 0.23
399 0.21
400 0.19
401 0.19
402 0.17
403 0.15
404 0.13
405 0.13
406 0.1
407 0.11
408 0.11
409 0.1
410 0.1
411 0.1
412 0.09
413 0.11
414 0.15
415 0.15
416 0.14
417 0.18
418 0.21
419 0.21
420 0.23
421 0.24
422 0.21
423 0.19
424 0.22
425 0.22
426 0.25
427 0.24
428 0.22
429 0.19
430 0.19
431 0.21
432 0.18
433 0.2
434 0.13
435 0.14
436 0.14
437 0.16
438 0.18
439 0.16
440 0.16
441 0.12
442 0.12
443 0.11
444 0.11
445 0.09
446 0.08
447 0.09
448 0.08
449 0.07
450 0.08
451 0.08
452 0.07
453 0.07
454 0.07
455 0.06
456 0.06
457 0.06
458 0.05
459 0.05
460 0.06
461 0.08
462 0.08
463 0.1
464 0.14
465 0.17
466 0.18
467 0.2
468 0.2
469 0.22
470 0.21
471 0.22
472 0.19
473 0.18
474 0.17
475 0.15
476 0.13
477 0.1
478 0.1
479 0.1
480 0.09
481 0.08
482 0.09
483 0.1
484 0.1
485 0.1
486 0.1
487 0.08
488 0.07
489 0.08
490 0.08
491 0.08
492 0.1
493 0.11
494 0.12
495 0.14
496 0.13
497 0.13
498 0.15
499 0.17
500 0.18
501 0.17
502 0.17
503 0.16
504 0.16
505 0.18
506 0.18
507 0.16
508 0.14
509 0.16
510 0.17
511 0.22
512 0.22
513 0.23
514 0.27
515 0.25
516 0.25
517 0.3
518 0.28
519 0.23
520 0.24
521 0.26
522 0.21
523 0.23
524 0.26
525 0.2
526 0.21
527 0.2
528 0.2
529 0.21
530 0.18
531 0.19
532 0.17
533 0.2
534 0.22
535 0.23
536 0.24
537 0.28
538 0.31
539 0.33
540 0.35
541 0.38
542 0.42
543 0.42
544 0.39
545 0.31
546 0.32
547 0.29
548 0.26
549 0.2
550 0.15
551 0.13
552 0.13
553 0.13
554 0.11
555 0.13
556 0.17
557 0.25
558 0.34
559 0.44
560 0.51
561 0.59
562 0.66
563 0.71
564 0.78
565 0.79
566 0.79
567 0.79
568 0.83
569 0.79
570 0.72
571 0.63
572 0.51
573 0.43
574 0.39
575 0.29
576 0.2
577 0.16
578 0.15
579 0.15
580 0.16
581 0.15
582 0.11
583 0.12
584 0.13
585 0.12
586 0.14
587 0.17
588 0.18
589 0.2
590 0.22
591 0.27
592 0.31
593 0.34
594 0.34
595 0.3
596 0.28
597 0.26
598 0.23