Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2DC05

Protein Details
Accession A0A0D2DC05    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
103-122IEDKRWRWWWPRFKAKFVNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8cyto 8cyto_mito 8, nucl 6
Family & Domain DBs
Amino Acid Sequences MTTPDGEQGLVKRLRSMHGGLYPQSYLVVVDDPYAEVAARTWIDEHAQLDRSQLLHMTYNDWIEQGEKKAAGLVAAVQELNGPFLPNQISGPLDDDITLVTGIEDKRWRWWWPRFKAKFVNAEQKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.31
4 0.28
5 0.3
6 0.33
7 0.31
8 0.32
9 0.3
10 0.26
11 0.24
12 0.18
13 0.12
14 0.1
15 0.1
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.05
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.09
31 0.1
32 0.11
33 0.11
34 0.13
35 0.13
36 0.13
37 0.13
38 0.13
39 0.11
40 0.11
41 0.1
42 0.11
43 0.11
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.1
50 0.09
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.09
58 0.08
59 0.06
60 0.06
61 0.05
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.07
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.08
74 0.09
75 0.09
76 0.09
77 0.09
78 0.12
79 0.11
80 0.1
81 0.1
82 0.1
83 0.08
84 0.09
85 0.08
86 0.05
87 0.05
88 0.08
89 0.08
90 0.12
91 0.16
92 0.16
93 0.23
94 0.28
95 0.33
96 0.39
97 0.49
98 0.56
99 0.63
100 0.73
101 0.72
102 0.77
103 0.81
104 0.8
105 0.79
106 0.77
107 0.77