Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2CPJ4

Protein Details
Accession A0A0D2CPJ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21LSRHPTFRTRRRPLVRGVLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000961  AGC-kinase_C  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
PROSITE View protein in PROSITE  
PS51285  AGC_KINASE_CTER  
Amino Acid Sequences MLSRHPTFRTRRRPLVRGVLQQALEEKGGHPPDMYTDAAELMERVLLGDSDPAVWKQSRQGIQLVEEDVWLADVVWNGLLRQRLRPPYVPPTKAAAGGASPCYMDEDDGHGAAEDDGRLRDERAPGRVACWPAVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.79
4 0.76
5 0.71
6 0.66
7 0.57
8 0.52
9 0.46
10 0.37
11 0.29
12 0.21
13 0.17
14 0.18
15 0.19
16 0.18
17 0.16
18 0.15
19 0.17
20 0.2
21 0.19
22 0.13
23 0.12
24 0.12
25 0.12
26 0.11
27 0.09
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.06
39 0.06
40 0.08
41 0.08
42 0.09
43 0.12
44 0.18
45 0.2
46 0.21
47 0.24
48 0.22
49 0.24
50 0.25
51 0.22
52 0.16
53 0.13
54 0.11
55 0.08
56 0.07
57 0.05
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.07
66 0.1
67 0.11
68 0.15
69 0.21
70 0.26
71 0.3
72 0.33
73 0.36
74 0.43
75 0.51
76 0.48
77 0.44
78 0.44
79 0.41
80 0.39
81 0.34
82 0.24
83 0.17
84 0.17
85 0.16
86 0.11
87 0.1
88 0.09
89 0.11
90 0.11
91 0.1
92 0.09
93 0.12
94 0.13
95 0.13
96 0.13
97 0.11
98 0.12
99 0.11
100 0.11
101 0.07
102 0.07
103 0.08
104 0.1
105 0.11
106 0.12
107 0.16
108 0.22
109 0.26
110 0.29
111 0.33
112 0.32
113 0.34
114 0.38
115 0.37
116 0.34