Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A3M1

Protein Details
Accession A0A0D2A3M1   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-83PPEMTREEKKEQKRKEKERRKSEAAKEREREBasic
NLS Segment(s)
PositionSequence
56-90MTREEKKEQKRKEKERRKSEAAKEREREGGVGRRR
Subcellular Location(s) cyto_nucl 11.833, nucl 11.5, cyto 10, mito_nucl 8.666, mito 4.5
Family & Domain DBs
Amino Acid Sequences MATFLSVGNGVVAKDGVAEGEAAQYQALKRRVLEEQERKRQEERERRVSLGLPPEMTREEKKEQKRKEKERRKSEAAKEREREGGVGRRRVLGMLCFGPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.04
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.15
14 0.18
15 0.18
16 0.18
17 0.21
18 0.25
19 0.3
20 0.39
21 0.43
22 0.49
23 0.59
24 0.62
25 0.62
26 0.61
27 0.62
28 0.62
29 0.62
30 0.6
31 0.6
32 0.59
33 0.57
34 0.55
35 0.49
36 0.42
37 0.37
38 0.29
39 0.2
40 0.18
41 0.18
42 0.19
43 0.2
44 0.19
45 0.19
46 0.24
47 0.31
48 0.41
49 0.49
50 0.57
51 0.66
52 0.75
53 0.81
54 0.86
55 0.89
56 0.9
57 0.91
58 0.91
59 0.89
60 0.87
61 0.86
62 0.85
63 0.83
64 0.82
65 0.75
66 0.69
67 0.65
68 0.56
69 0.47
70 0.43
71 0.43
72 0.41
73 0.45
74 0.43
75 0.4
76 0.4
77 0.4
78 0.36
79 0.3
80 0.27