Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2C9Y5

Protein Details
Accession A0A0D2C9Y5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-35RKRMWVRVRFSSWRRRRRGRRRDEGRATTRSRBasic
NLS Segment(s)
PositionSequence
5-29KRMWVRVRFSSWRRRRRGRRRDEGR
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MRIRKRMWVRVRFSSWRRRRRGRRRDEGRATTRSREGSSFCAMGILYDDNLQPRSSLCLCLPISHLQKGLHRVQRSPAEGRSTAERLGRGSPCARRVTCLHGHGTRMKGEGESGNNTRWQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.82
5 0.84
6 0.87
7 0.89
8 0.92
9 0.92
10 0.93
11 0.92
12 0.93
13 0.92
14 0.91
15 0.87
16 0.83
17 0.76
18 0.7
19 0.64
20 0.55
21 0.47
22 0.39
23 0.34
24 0.3
25 0.29
26 0.25
27 0.2
28 0.18
29 0.16
30 0.14
31 0.13
32 0.09
33 0.06
34 0.07
35 0.08
36 0.08
37 0.1
38 0.1
39 0.08
40 0.08
41 0.12
42 0.12
43 0.13
44 0.12
45 0.17
46 0.17
47 0.18
48 0.2
49 0.22
50 0.24
51 0.24
52 0.26
53 0.21
54 0.24
55 0.28
56 0.33
57 0.33
58 0.32
59 0.32
60 0.35
61 0.4
62 0.41
63 0.39
64 0.35
65 0.34
66 0.33
67 0.34
68 0.33
69 0.29
70 0.27
71 0.26
72 0.24
73 0.2
74 0.24
75 0.24
76 0.23
77 0.26
78 0.29
79 0.33
80 0.39
81 0.38
82 0.37
83 0.39
84 0.42
85 0.44
86 0.43
87 0.44
88 0.39
89 0.43
90 0.45
91 0.45
92 0.4
93 0.35
94 0.32
95 0.25
96 0.25
97 0.26
98 0.24
99 0.28
100 0.29
101 0.3