Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WIL5

Protein Details
Accession B2WIL5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-74KTPKWVPRISNTKRTRRQEQERRDHSESRHydrophilic
NLS Segment(s)
PositionSequence
46-49KTPK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MESVEREPSQRKLCNQGVMLQQQLPAFPEESRQNSGTLEAPTKKAKTPKWVPRISNTKRTRRQEQERRDHSESRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.5
4 0.48
5 0.45
6 0.43
7 0.35
8 0.32
9 0.26
10 0.25
11 0.2
12 0.15
13 0.13
14 0.11
15 0.14
16 0.16
17 0.2
18 0.23
19 0.22
20 0.22
21 0.21
22 0.22
23 0.2
24 0.17
25 0.17
26 0.15
27 0.17
28 0.2
29 0.21
30 0.23
31 0.28
32 0.3
33 0.37
34 0.46
35 0.54
36 0.6
37 0.67
38 0.66
39 0.69
40 0.76
41 0.72
42 0.73
43 0.72
44 0.73
45 0.75
46 0.8
47 0.81
48 0.81
49 0.86
50 0.86
51 0.88
52 0.88
53 0.87
54 0.88
55 0.84