Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VW83

Protein Details
Accession B2VW83    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-44QERQNDLCRFWRRRRPRPSRPQSERRWEILHydrophilic
NLS Segment(s)
PositionSequence
26-36RRRRPRPSRPQ
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MTYNCKQGERKLLCQERQNDLCRFWRRRRPRPSRPQSERRWEILWPKFCKEKKYRTLKSDTEEQERLNAIAAGRANNKPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.67
4 0.67
5 0.65
6 0.57
7 0.52
8 0.56
9 0.57
10 0.59
11 0.59
12 0.64
13 0.68
14 0.76
15 0.83
16 0.85
17 0.87
18 0.91
19 0.92
20 0.92
21 0.91
22 0.91
23 0.88
24 0.88
25 0.81
26 0.72
27 0.63
28 0.54
29 0.53
30 0.51
31 0.5
32 0.43
33 0.42
34 0.47
35 0.48
36 0.55
37 0.54
38 0.57
39 0.59
40 0.67
41 0.72
42 0.7
43 0.76
44 0.72
45 0.69
46 0.68
47 0.63
48 0.59
49 0.54
50 0.47
51 0.42
52 0.38
53 0.34
54 0.25
55 0.22
56 0.14
57 0.16
58 0.17
59 0.18
60 0.21
61 0.27