Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2C6I4

Protein Details
Accession A0A0D2C6I4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-29AETLRSKQKPLKDKYRSDPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015946  KH_dom-like_a/b  
IPR003718  OsmC/Ohr_fam  
IPR036102  OsmC/Ohrsf  
Pfam View protein in Pfam  
PF02566  OsmC  
Amino Acid Sequences MSDAATRAAETLRSKQKPLKDKYRSDPSSALVTLSSSGTLDPTSTSLTCSLSTSTAARKVAGLHRAAGGEGFDASGELCSGDMLLESLVACFGVTVRAVATSLGIPINNGTITVEGDLDFRGTMGIKDPEGNPAPVGFTKIRLIVRLDVDEEHKSKVNKLIELSERYCVVLQTLKGGVNVDTQLGHVGNVVPDARKDEDETVNQGKGEGMSDIPPNEAVLKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.57
4 0.62
5 0.68
6 0.7
7 0.7
8 0.76
9 0.8
10 0.85
11 0.8
12 0.75
13 0.68
14 0.6
15 0.56
16 0.47
17 0.38
18 0.26
19 0.24
20 0.19
21 0.16
22 0.14
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.11
31 0.1
32 0.12
33 0.12
34 0.14
35 0.14
36 0.14
37 0.14
38 0.12
39 0.14
40 0.14
41 0.17
42 0.2
43 0.2
44 0.19
45 0.19
46 0.21
47 0.25
48 0.28
49 0.26
50 0.22
51 0.23
52 0.23
53 0.22
54 0.18
55 0.13
56 0.08
57 0.07
58 0.06
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.02
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.07
112 0.08
113 0.08
114 0.09
115 0.1
116 0.14
117 0.16
118 0.16
119 0.13
120 0.12
121 0.14
122 0.12
123 0.16
124 0.11
125 0.12
126 0.13
127 0.17
128 0.17
129 0.18
130 0.2
131 0.19
132 0.2
133 0.2
134 0.19
135 0.17
136 0.19
137 0.21
138 0.2
139 0.19
140 0.21
141 0.2
142 0.22
143 0.28
144 0.28
145 0.27
146 0.27
147 0.31
148 0.33
149 0.38
150 0.38
151 0.33
152 0.3
153 0.29
154 0.27
155 0.21
156 0.17
157 0.15
158 0.14
159 0.15
160 0.16
161 0.16
162 0.16
163 0.17
164 0.16
165 0.15
166 0.15
167 0.13
168 0.11
169 0.1
170 0.12
171 0.11
172 0.1
173 0.08
174 0.09
175 0.08
176 0.1
177 0.11
178 0.1
179 0.11
180 0.15
181 0.17
182 0.18
183 0.21
184 0.24
185 0.28
186 0.3
187 0.36
188 0.35
189 0.34
190 0.33
191 0.3
192 0.26
193 0.21
194 0.19
195 0.14
196 0.11
197 0.12
198 0.15
199 0.16
200 0.16
201 0.16
202 0.16
203 0.16