Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W3N0

Protein Details
Accession B2W3N0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
94-128MICRKCYARLPPRAVNCRKKKCGHTNQLRPKKKLKHydrophilic
NLS Segment(s)
PositionSequence
122-128RPKKKLK
Subcellular Location(s) nucl 18, cyto_nucl 16, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLECETSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKMICRKCYARLPPRAVNCRKKKCGHTNQLRPKKKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.19
4 0.2
5 0.2
6 0.2
7 0.18
8 0.16
9 0.15
10 0.18
11 0.19
12 0.17
13 0.19
14 0.2
15 0.23
16 0.26
17 0.28
18 0.31
19 0.31
20 0.4
21 0.43
22 0.43
23 0.41
24 0.41
25 0.4
26 0.38
27 0.37
28 0.28
29 0.24
30 0.24
31 0.23
32 0.21
33 0.21
34 0.17
35 0.2
36 0.2
37 0.18
38 0.16
39 0.15
40 0.15
41 0.13
42 0.13
43 0.1
44 0.16
45 0.17
46 0.18
47 0.2
48 0.18
49 0.17
50 0.17
51 0.19
52 0.15
53 0.14
54 0.11
55 0.13
56 0.14
57 0.15
58 0.15
59 0.13
60 0.11
61 0.1
62 0.1
63 0.08
64 0.07
65 0.08
66 0.07
67 0.08
68 0.09
69 0.08
70 0.08
71 0.08
72 0.14
73 0.15
74 0.2
75 0.23
76 0.29
77 0.31
78 0.32
79 0.36
80 0.4
81 0.48
82 0.47
83 0.47
84 0.46
85 0.5
86 0.58
87 0.65
88 0.64
89 0.63
90 0.67
91 0.7
92 0.75
93 0.8
94 0.8
95 0.8
96 0.82
97 0.82
98 0.84
99 0.84
100 0.85
101 0.86
102 0.88
103 0.88
104 0.88
105 0.89
106 0.91
107 0.95
108 0.94