Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2CQB6

Protein Details
Accession A0A0D2CQB6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-51RSLFKKKHSGEEPPRRPKKRRPSDPYSGLSBasic
NLS Segment(s)
PositionSequence
25-43FKKKHSGEEPPRRPKKRRP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSEAKIPLHKPETDQTMWEKLRSLFKKKHSGEEPPRRPKKRRPSDPYSGLSEVAVPPPIQNRDESEVFLHHTLEENLERSSRGQDSEGEAASGDILVRHHTLDENIRLARSLSLELRRQSEELRRRSSEYERIANHRDSHSPRSVPSHHPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.43
4 0.43
5 0.39
6 0.36
7 0.33
8 0.41
9 0.45
10 0.49
11 0.48
12 0.55
13 0.65
14 0.64
15 0.7
16 0.65
17 0.7
18 0.72
19 0.76
20 0.78
21 0.78
22 0.86
23 0.85
24 0.87
25 0.86
26 0.87
27 0.87
28 0.87
29 0.85
30 0.83
31 0.85
32 0.85
33 0.78
34 0.73
35 0.62
36 0.51
37 0.42
38 0.34
39 0.25
40 0.18
41 0.15
42 0.09
43 0.08
44 0.12
45 0.15
46 0.14
47 0.15
48 0.17
49 0.21
50 0.22
51 0.22
52 0.19
53 0.17
54 0.18
55 0.18
56 0.14
57 0.1
58 0.1
59 0.09
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.11
68 0.1
69 0.11
70 0.1
71 0.11
72 0.14
73 0.16
74 0.15
75 0.12
76 0.12
77 0.1
78 0.09
79 0.08
80 0.05
81 0.03
82 0.04
83 0.05
84 0.06
85 0.06
86 0.07
87 0.08
88 0.1
89 0.13
90 0.16
91 0.17
92 0.17
93 0.17
94 0.17
95 0.17
96 0.16
97 0.14
98 0.14
99 0.15
100 0.2
101 0.25
102 0.28
103 0.3
104 0.32
105 0.31
106 0.33
107 0.38
108 0.42
109 0.45
110 0.5
111 0.49
112 0.51
113 0.55
114 0.58
115 0.57
116 0.55
117 0.54
118 0.52
119 0.55
120 0.57
121 0.56
122 0.54
123 0.48
124 0.5
125 0.48
126 0.51
127 0.52
128 0.49
129 0.48
130 0.51
131 0.53
132 0.53