Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2CR87

Protein Details
Accession A0A0D2CR87    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VSAKKHVPIIKKHKKAWHRHQSDTFKCVPSAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
10-17IIKKHKKA
36-37PK
44-45RR
Subcellular Location(s) mito 16.5, mito_nucl 11.5, nucl 5.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIIKKHKKAWHRHQSDTFKCVPSAWRKPKGIDNRVRRRFKGQMVMPSIGFGSNKKTRHMMPSGHKAFLVHNPRDVELLLMHNRTYAAEIASAVSSRKRIEIVAKAKALGVKVTNPKAKITTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.86
4 0.86
5 0.86
6 0.83
7 0.83
8 0.85
9 0.86
10 0.82
11 0.77
12 0.7
13 0.61
14 0.54
15 0.46
16 0.43
17 0.42
18 0.47
19 0.51
20 0.55
21 0.55
22 0.58
23 0.66
24 0.69
25 0.7
26 0.68
27 0.7
28 0.72
29 0.8
30 0.83
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.32
62 0.34
63 0.35
64 0.26
65 0.27
66 0.28
67 0.28
68 0.29
69 0.27
70 0.19
71 0.13
72 0.16
73 0.14
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.1
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.34
97 0.39
98 0.4
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.46
111 0.46