Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2CDD9

Protein Details
Accession A0A0D2CDD9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
456-479ADGLQQHLQRKRRRPIRNFIVARYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001296  Glyco_trans_1  
IPR028098  Glyco_trans_4-like_N  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF13579  Glyco_trans_4_4  
PF00534  Glycos_transf_1  
CDD cd03814  GT4-like  
Amino Acid Sequences MRVDEASGREKDTLPAPITASSNDRTKTTTPAAPEALSPPSSKSPQPQAAAGTDTAAPDKRDAFPSYLQGKRVLLATESLGPVNGVSRTTLMLIEYLRRNGVQLAIVAPHSRQSRLKPTTGANLTEFRLPGYELPYNPDLTVVYPFQLDDVYKHTFKPDIVYLASPASTGFQMLFQIRQLHDPPVVLLNFQTDLSAYSEILFPGPVARFSVWLLGVVQGFLFNHRTVHTIFYPSSGVRRYLEKAGAPSNKMVRLGRGVDTTLFNPSQRDEAYHKELAPNGEIILVCVCRLAPEKGFEFLAQVAMRLAQEGFPFKLLIVGGNMSAEVEDQVHHLFDNVAEHVIFTGFRTGVDLARAYATGDIFLHCSITETFGLVVLEAMASGLPVIARDEGGPSDIVQDRETGYLVPPHNLAQYIALIKSLSTDKTFRAKMAIAARRYTCDVTWEKINRRVAWHMADGLQQHLQRKRRRPIRNFIVARYHELRDGVVIPVVVRLRLYMAAMIVYLIWLMTAVVLLLYGHRVFSRAAQLLRNPPLVLQRIQYRALKQGIQETLKSLSTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.29
5 0.3
6 0.29
7 0.3
8 0.27
9 0.31
10 0.3
11 0.3
12 0.31
13 0.32
14 0.36
15 0.38
16 0.38
17 0.36
18 0.4
19 0.41
20 0.37
21 0.37
22 0.33
23 0.31
24 0.29
25 0.25
26 0.24
27 0.28
28 0.3
29 0.32
30 0.36
31 0.42
32 0.48
33 0.5
34 0.48
35 0.45
36 0.44
37 0.44
38 0.37
39 0.29
40 0.22
41 0.2
42 0.2
43 0.19
44 0.18
45 0.17
46 0.2
47 0.21
48 0.25
49 0.27
50 0.29
51 0.29
52 0.36
53 0.42
54 0.43
55 0.42
56 0.41
57 0.38
58 0.35
59 0.35
60 0.28
61 0.2
62 0.18
63 0.18
64 0.18
65 0.18
66 0.17
67 0.15
68 0.13
69 0.12
70 0.13
71 0.12
72 0.09
73 0.08
74 0.09
75 0.1
76 0.11
77 0.11
78 0.1
79 0.11
80 0.11
81 0.16
82 0.19
83 0.2
84 0.2
85 0.2
86 0.2
87 0.19
88 0.2
89 0.15
90 0.13
91 0.13
92 0.13
93 0.14
94 0.14
95 0.13
96 0.17
97 0.18
98 0.21
99 0.23
100 0.29
101 0.39
102 0.43
103 0.46
104 0.45
105 0.46
106 0.52
107 0.51
108 0.48
109 0.4
110 0.38
111 0.35
112 0.34
113 0.31
114 0.21
115 0.19
116 0.17
117 0.15
118 0.17
119 0.2
120 0.17
121 0.22
122 0.24
123 0.24
124 0.23
125 0.22
126 0.17
127 0.14
128 0.17
129 0.12
130 0.11
131 0.1
132 0.1
133 0.1
134 0.11
135 0.1
136 0.08
137 0.12
138 0.17
139 0.17
140 0.18
141 0.19
142 0.2
143 0.2
144 0.23
145 0.21
146 0.19
147 0.2
148 0.2
149 0.19
150 0.18
151 0.18
152 0.14
153 0.11
154 0.09
155 0.08
156 0.07
157 0.06
158 0.06
159 0.08
160 0.09
161 0.1
162 0.11
163 0.15
164 0.15
165 0.19
166 0.2
167 0.21
168 0.21
169 0.2
170 0.19
171 0.19
172 0.18
173 0.15
174 0.13
175 0.12
176 0.12
177 0.11
178 0.11
179 0.06
180 0.08
181 0.1
182 0.1
183 0.09
184 0.09
185 0.09
186 0.09
187 0.09
188 0.08
189 0.06
190 0.08
191 0.08
192 0.08
193 0.09
194 0.09
195 0.1
196 0.11
197 0.13
198 0.1
199 0.1
200 0.1
201 0.1
202 0.09
203 0.08
204 0.08
205 0.06
206 0.06
207 0.07
208 0.09
209 0.08
210 0.09
211 0.09
212 0.11
213 0.12
214 0.15
215 0.15
216 0.16
217 0.16
218 0.16
219 0.17
220 0.16
221 0.18
222 0.16
223 0.16
224 0.15
225 0.17
226 0.19
227 0.2
228 0.22
229 0.2
230 0.21
231 0.26
232 0.28
233 0.26
234 0.26
235 0.26
236 0.25
237 0.27
238 0.24
239 0.19
240 0.19
241 0.2
242 0.19
243 0.17
244 0.16
245 0.15
246 0.16
247 0.15
248 0.15
249 0.13
250 0.12
251 0.12
252 0.12
253 0.13
254 0.12
255 0.14
256 0.14
257 0.19
258 0.24
259 0.25
260 0.25
261 0.24
262 0.26
263 0.23
264 0.21
265 0.16
266 0.1
267 0.1
268 0.1
269 0.09
270 0.08
271 0.07
272 0.06
273 0.06
274 0.05
275 0.05
276 0.08
277 0.09
278 0.09
279 0.12
280 0.13
281 0.14
282 0.15
283 0.14
284 0.12
285 0.11
286 0.12
287 0.1
288 0.09
289 0.08
290 0.08
291 0.08
292 0.07
293 0.07
294 0.06
295 0.07
296 0.08
297 0.09
298 0.09
299 0.09
300 0.08
301 0.1
302 0.08
303 0.08
304 0.07
305 0.07
306 0.06
307 0.06
308 0.06
309 0.04
310 0.04
311 0.04
312 0.04
313 0.03
314 0.04
315 0.05
316 0.05
317 0.05
318 0.05
319 0.06
320 0.05
321 0.06
322 0.07
323 0.06
324 0.07
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.05
331 0.07
332 0.06
333 0.06
334 0.08
335 0.09
336 0.09
337 0.1
338 0.1
339 0.09
340 0.09
341 0.09
342 0.08
343 0.08
344 0.08
345 0.07
346 0.07
347 0.07
348 0.08
349 0.07
350 0.07
351 0.06
352 0.08
353 0.08
354 0.1
355 0.1
356 0.09
357 0.09
358 0.09
359 0.09
360 0.07
361 0.07
362 0.05
363 0.04
364 0.04
365 0.04
366 0.02
367 0.02
368 0.02
369 0.02
370 0.02
371 0.03
372 0.04
373 0.04
374 0.05
375 0.05
376 0.06
377 0.07
378 0.08
379 0.08
380 0.07
381 0.11
382 0.13
383 0.14
384 0.13
385 0.14
386 0.14
387 0.14
388 0.15
389 0.11
390 0.1
391 0.15
392 0.16
393 0.16
394 0.16
395 0.16
396 0.17
397 0.17
398 0.16
399 0.11
400 0.13
401 0.13
402 0.12
403 0.12
404 0.1
405 0.1
406 0.12
407 0.13
408 0.12
409 0.13
410 0.15
411 0.18
412 0.26
413 0.27
414 0.25
415 0.27
416 0.26
417 0.29
418 0.37
419 0.41
420 0.36
421 0.4
422 0.41
423 0.4
424 0.43
425 0.39
426 0.29
427 0.29
428 0.29
429 0.27
430 0.35
431 0.4
432 0.43
433 0.49
434 0.55
435 0.51
436 0.52
437 0.54
438 0.5
439 0.46
440 0.42
441 0.37
442 0.32
443 0.32
444 0.28
445 0.26
446 0.26
447 0.24
448 0.29
449 0.34
450 0.41
451 0.48
452 0.57
453 0.65
454 0.71
455 0.79
456 0.82
457 0.85
458 0.87
459 0.89
460 0.83
461 0.78
462 0.78
463 0.69
464 0.67
465 0.6
466 0.51
467 0.43
468 0.39
469 0.33
470 0.25
471 0.24
472 0.18
473 0.15
474 0.13
475 0.11
476 0.15
477 0.15
478 0.13
479 0.12
480 0.11
481 0.12
482 0.13
483 0.13
484 0.1
485 0.1
486 0.1
487 0.09
488 0.09
489 0.07
490 0.06
491 0.05
492 0.04
493 0.03
494 0.03
495 0.03
496 0.03
497 0.03
498 0.03
499 0.03
500 0.03
501 0.03
502 0.04
503 0.07
504 0.07
505 0.09
506 0.09
507 0.11
508 0.11
509 0.15
510 0.23
511 0.26
512 0.28
513 0.32
514 0.39
515 0.46
516 0.51
517 0.5
518 0.42
519 0.39
520 0.44
521 0.43
522 0.39
523 0.36
524 0.38
525 0.4
526 0.45
527 0.48
528 0.44
529 0.47
530 0.49
531 0.47
532 0.42
533 0.46
534 0.48
535 0.47
536 0.44
537 0.39
538 0.38