Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2CDJ9

Protein Details
Accession A0A0D2CDJ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-119TKGTKGTKGTKGAKRRKRTSNKDRKKLFPBasic
NLS Segment(s)
PositionSequence
71-119KGAKGAKGTKGTKGTKGTKGTKGTKGTKGTKGAKRRKRTSNKDRKKLFP
Subcellular Location(s) extr 15, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MFLTCQLWRSLQSPVYDHGVVEDGIQVTIVTIVTIVTSVTIVTIVTIVTSVTNVTSVTNVTSVTSVTEGTKGAKGAKGTKGTKGTKGTKGTKGTKGTKGTKGAKRRKRTSNKDRKKLFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.3
4 0.28
5 0.23
6 0.21
7 0.18
8 0.15
9 0.15
10 0.09
11 0.09
12 0.09
13 0.08
14 0.06
15 0.06
16 0.06
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.08
57 0.09
58 0.09
59 0.1
60 0.11
61 0.13
62 0.17
63 0.22
64 0.29
65 0.29
66 0.35
67 0.42
68 0.43
69 0.47
70 0.5
71 0.51
72 0.51
73 0.57
74 0.57
75 0.57
76 0.62
77 0.62
78 0.61
79 0.63
80 0.62
81 0.61
82 0.63
83 0.62
84 0.61
85 0.64
86 0.66
87 0.67
88 0.72
89 0.75
90 0.77
91 0.82
92 0.84
93 0.86
94 0.88
95 0.91
96 0.91
97 0.92
98 0.93
99 0.93