Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2C8K3

Protein Details
Accession A0A0D2C8K3   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-122QPVRCACHWHPRKRGVRRLPRKHRPCCSIHABasic
NLS Segment(s)
PositionSequence
102-115PRKRGVRRLPRKHR
Subcellular Location(s) cyto_nucl 8, nucl 7.5, cyto 7.5, mito 7, extr 3
Family & Domain DBs
Amino Acid Sequences MKPAASSLAHVVPPAAVDSTTCMGGIRVLANSRPLIGSHSSDHGKERGIGRNSPSSGQDWNEPLYSISSRSSQNGLEWTVDNYNSHHAIVIQPVRCACHWHPRKRGVRRLPRKHRPCCSIHAGESSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.07
4 0.07
5 0.1
6 0.11
7 0.12
8 0.11
9 0.1
10 0.09
11 0.1
12 0.11
13 0.08
14 0.09
15 0.1
16 0.11
17 0.14
18 0.14
19 0.14
20 0.13
21 0.12
22 0.14
23 0.15
24 0.16
25 0.15
26 0.2
27 0.2
28 0.21
29 0.23
30 0.21
31 0.19
32 0.2
33 0.22
34 0.26
35 0.28
36 0.29
37 0.3
38 0.35
39 0.35
40 0.33
41 0.3
42 0.23
43 0.22
44 0.21
45 0.2
46 0.16
47 0.16
48 0.15
49 0.14
50 0.13
51 0.12
52 0.11
53 0.1
54 0.1
55 0.11
56 0.12
57 0.13
58 0.14
59 0.13
60 0.14
61 0.15
62 0.14
63 0.13
64 0.13
65 0.14
66 0.13
67 0.14
68 0.13
69 0.12
70 0.14
71 0.14
72 0.13
73 0.12
74 0.11
75 0.11
76 0.16
77 0.21
78 0.19
79 0.19
80 0.2
81 0.22
82 0.22
83 0.28
84 0.26
85 0.31
86 0.4
87 0.48
88 0.57
89 0.65
90 0.75
91 0.79
92 0.86
93 0.86
94 0.88
95 0.89
96 0.92
97 0.93
98 0.94
99 0.94
100 0.94
101 0.92
102 0.88
103 0.83
104 0.79
105 0.77
106 0.72
107 0.66