Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2CJA2

Protein Details
Accession A0A0D2CJA2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
179-213FWCECGKSYKRRDHLIRHGRKCRRSQQRMARKSHGBasic
NLS Segment(s)
PositionSequence
195-210RHGRKCRRSQQRMARK
Subcellular Location(s) extr 14, E.R. 4, plas 3, cyto 2, nucl 1, mito 1, pero 1, golg 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MTCQGIPGIGCLCDLCGLVVLFDDISAYPPLIDLTTTPSSMMSHRESRETSVSNLHVQQPNVVERDPQILSIPRIGSAELMENSSFNLSLHEPGGVEGNPQSLTPASLTMPSVLRCPHCKQCYGSGPLQAQRFREHLAKHVSQRCDFQGCGVILKNDRRTLERHLRTVHIAPSRAPEYFWCECGKSYKRRDHLIRHGRKCRRSQQRMARKSHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.09
4 0.09
5 0.08
6 0.09
7 0.09
8 0.07
9 0.07
10 0.07
11 0.05
12 0.08
13 0.08
14 0.08
15 0.07
16 0.08
17 0.08
18 0.08
19 0.08
20 0.06
21 0.12
22 0.14
23 0.15
24 0.15
25 0.15
26 0.16
27 0.17
28 0.21
29 0.19
30 0.24
31 0.25
32 0.3
33 0.3
34 0.33
35 0.37
36 0.34
37 0.31
38 0.3
39 0.3
40 0.29
41 0.3
42 0.33
43 0.31
44 0.29
45 0.3
46 0.28
47 0.29
48 0.27
49 0.25
50 0.19
51 0.17
52 0.21
53 0.18
54 0.16
55 0.15
56 0.16
57 0.17
58 0.19
59 0.18
60 0.15
61 0.15
62 0.14
63 0.12
64 0.1
65 0.12
66 0.09
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.06
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.09
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.1
100 0.11
101 0.13
102 0.16
103 0.21
104 0.29
105 0.3
106 0.32
107 0.33
108 0.39
109 0.44
110 0.44
111 0.42
112 0.38
113 0.38
114 0.4
115 0.42
116 0.37
117 0.32
118 0.29
119 0.29
120 0.27
121 0.29
122 0.25
123 0.27
124 0.32
125 0.35
126 0.4
127 0.45
128 0.46
129 0.44
130 0.46
131 0.43
132 0.39
133 0.34
134 0.27
135 0.26
136 0.22
137 0.23
138 0.21
139 0.2
140 0.22
141 0.28
142 0.32
143 0.3
144 0.31
145 0.31
146 0.34
147 0.4
148 0.47
149 0.46
150 0.48
151 0.47
152 0.48
153 0.5
154 0.5
155 0.48
156 0.42
157 0.38
158 0.33
159 0.36
160 0.35
161 0.31
162 0.29
163 0.24
164 0.26
165 0.27
166 0.28
167 0.25
168 0.24
169 0.25
170 0.34
171 0.39
172 0.41
173 0.49
174 0.57
175 0.61
176 0.7
177 0.77
178 0.78
179 0.81
180 0.83
181 0.84
182 0.85
183 0.89
184 0.88
185 0.89
186 0.88
187 0.88
188 0.88
189 0.87
190 0.87
191 0.88
192 0.89
193 0.9