FuNGI

A0A0D2B417

Protein Details

Accession

A0A0D2B417

Localization Confidence

Low

Confidence Score

7.5

NoLS Segment(s)

Position	Sequence	Protein Nature
42-64	QACLTVRPPRRAGRRPQHADHSA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 10, nucl 7, cyto 5, plas 3, cyto_pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf
Gene Ontology	GO:0003677 F:DNA binding GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding

Amino Acid Sequences

MASVTAQRRGVRAACDRCYELKERCQRVSLTATCVRCDRLGQACLTVRPPRRAGRRPQHADHSASQTSSSRSSSDAQSERDVGAWLRDVPGLCPEERDLMSFLLYQPQTLQFYVVGSSFEDAEQKSFEAPLPAALPVLKDAYLAYAGGLKGFQSDKPMDVNVDANLRHASSAMRTLRMLPITSAEDAALCLTVGMALALYIYTEVGVGVPDICRYCLSRARPYIEPAASIPGTEPQLVFLVLLEIMDCAVHRRKPTLRIQSPPAKGVDRHLGFCLPLLPYYYDLCAISHSLIDASNASFVYTLHQHLRSIQAAVNAWQPSTPEHFVNEFSSVEVVHLLAQARVYRLAALLMAHRLQHEFGQEDGQADIWSREVLMELELARRTTQRSIRFVTLPFIVAAIEIRDPAARTKAVQDVDEYVDRFMPVVQEATRTFLSRIWRERDAQGIRAWFDSVHKPCVILDSLGSSRCMGFLQTQGK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.52
3	0.54
4	0.53
5	0.55
6	0.54
7	0.51
8	0.53
9	0.58
10	0.6
11	0.6
12	0.61
13	0.57
14	0.56
15	0.58
16	0.51
17	0.48
18	0.48
19	0.46
20	0.43
21	0.44
22	0.41
23	0.34
24	0.32
25	0.3
26	0.31
27	0.33
28	0.32
29	0.36
30	0.37
31	0.38
32	0.41
33	0.44
34	0.43
35	0.47
36	0.52
37	0.55
38	0.62
39	0.68
40	0.74
41	0.76
42	0.81
43	0.82
44	0.83
45	0.83
46	0.78
47	0.75
48	0.69
49	0.66
50	0.56
51	0.48
52	0.43
53	0.36
54	0.33
55	0.31
56	0.27
57	0.2
58	0.21
59	0.24
60	0.25
61	0.31
62	0.33
63	0.32
64	0.34
65	0.35
66	0.33
67	0.3
68	0.28
69	0.2
70	0.17
71	0.16
72	0.13
73	0.13
74	0.15
75	0.14
76	0.14
77	0.19
78	0.2
79	0.18
80	0.19
81	0.19
82	0.22
83	0.22
84	0.23
85	0.19
86	0.17
87	0.18
88	0.17
89	0.16
90	0.19
91	0.18
92	0.16
93	0.17
94	0.2
95	0.21
96	0.2
97	0.21
98	0.13
99	0.14
100	0.15
101	0.13
102	0.11
103	0.09
104	0.09
105	0.08
106	0.08
107	0.1
108	0.1
109	0.1
110	0.1
111	0.11
112	0.1
113	0.11
114	0.11
115	0.11
116	0.11
117	0.11
118	0.11
119	0.11
120	0.11
121	0.1
122	0.1
123	0.09
124	0.1
125	0.08
126	0.07
127	0.07
128	0.08
129	0.08
130	0.08
131	0.06
132	0.08
133	0.08
134	0.08
135	0.08
136	0.07
137	0.09
138	0.1
139	0.1
140	0.12
141	0.13
142	0.15
143	0.16
144	0.17
145	0.16
146	0.16
147	0.16
148	0.13
149	0.15
150	0.14
151	0.13
152	0.13
153	0.13
154	0.11
155	0.11
156	0.1
157	0.08
158	0.16
159	0.16
160	0.17
161	0.17
162	0.19
163	0.21
164	0.22
165	0.21
166	0.13
167	0.15
168	0.15
169	0.15
170	0.14
171	0.11
172	0.1
173	0.09
174	0.09
175	0.06
176	0.04
177	0.03
178	0.03
179	0.03
180	0.03
181	0.02
182	0.02
183	0.02
184	0.02
185	0.02
186	0.02
187	0.02
188	0.02
189	0.02
190	0.02
191	0.02
192	0.03
193	0.03
194	0.03
195	0.03
196	0.04
197	0.05
198	0.05
199	0.06
200	0.06
201	0.08
202	0.11
203	0.17
204	0.21
205	0.28
206	0.32
207	0.35
208	0.36
209	0.38
210	0.4
211	0.34
212	0.3
213	0.23
214	0.23
215	0.18
216	0.16
217	0.14
218	0.11
219	0.11
220	0.11
221	0.1
222	0.08
223	0.08
224	0.08
225	0.08
226	0.05
227	0.05
228	0.04
229	0.04
230	0.03
231	0.03
232	0.03
233	0.03
234	0.03
235	0.05
236	0.08
237	0.11
238	0.12
239	0.17
240	0.2
241	0.28
242	0.37
243	0.45
244	0.47
245	0.5
246	0.56
247	0.61
248	0.59
249	0.54
250	0.47
251	0.38
252	0.33
253	0.32
254	0.34
255	0.26
256	0.26
257	0.24
258	0.23
259	0.21
260	0.2
261	0.19
262	0.1
263	0.09
264	0.1
265	0.09
266	0.1
267	0.11
268	0.11
269	0.11
270	0.1
271	0.1
272	0.09
273	0.09
274	0.08
275	0.07
276	0.07
277	0.06
278	0.06
279	0.06
280	0.06
281	0.06
282	0.06
283	0.06
284	0.06
285	0.06
286	0.06
287	0.08
288	0.09
289	0.11
290	0.14
291	0.15
292	0.15
293	0.17
294	0.21
295	0.19
296	0.19
297	0.18
298	0.17
299	0.17
300	0.18
301	0.22
302	0.18
303	0.17
304	0.16
305	0.15
306	0.14
307	0.19
308	0.2
309	0.16
310	0.18
311	0.19
312	0.2
313	0.21
314	0.21
315	0.16
316	0.14
317	0.13
318	0.11
319	0.1
320	0.09
321	0.07
322	0.05
323	0.07
324	0.07
325	0.07
326	0.09
327	0.09
328	0.1
329	0.11
330	0.11
331	0.09
332	0.09
333	0.09
334	0.08
335	0.08
336	0.08
337	0.1
338	0.11
339	0.11
340	0.12
341	0.13
342	0.13
343	0.14
344	0.15
345	0.14
346	0.13
347	0.15
348	0.15
349	0.15
350	0.14
351	0.13
352	0.11
353	0.1
354	0.1
355	0.08
356	0.07
357	0.06
358	0.06
359	0.06
360	0.07
361	0.06
362	0.08
363	0.08
364	0.11
365	0.12
366	0.13
367	0.14
368	0.15
369	0.18
370	0.24
371	0.3
372	0.35
373	0.4
374	0.44
375	0.48
376	0.5
377	0.48
378	0.44
379	0.38
380	0.31
381	0.25
382	0.2
383	0.15
384	0.12
385	0.11
386	0.09
387	0.08
388	0.07
389	0.08
390	0.09
391	0.1
392	0.13
393	0.16
394	0.15
395	0.16
396	0.2
397	0.26
398	0.27
399	0.27
400	0.26
401	0.25
402	0.29
403	0.31
404	0.28
405	0.22
406	0.21
407	0.2
408	0.19
409	0.16
410	0.13
411	0.11
412	0.13
413	0.13
414	0.16
415	0.17
416	0.21
417	0.22
418	0.22
419	0.22
420	0.22
421	0.3
422	0.34
423	0.42
424	0.43
425	0.47
426	0.49
427	0.51
428	0.58
429	0.53
430	0.49
431	0.46
432	0.44
433	0.41
434	0.38
435	0.36
436	0.27
437	0.27
438	0.32
439	0.32
440	0.33
441	0.32
442	0.31
443	0.31
444	0.34
445	0.32
446	0.24
447	0.2
448	0.21
449	0.24
450	0.25
451	0.25
452	0.22
453	0.19
454	0.19
455	0.19
456	0.14
457	0.14

A0A0D2B417

3D AlphaFold-predicted Structure Viewer