Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W3P0

Protein Details
Accession B2W3P0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-86FPSRYWTKQIKEHERKQNQSVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 6, nucl 5, cyto 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGGPKIPYPKHVWSPSGGWYAQPNNWKANTAVVGLTMASIAGMAFMLSANREYRDKMPERHRFFPSRYWTKQIKEHERKQNQSVIEKVLDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.47
4 0.45
5 0.37
6 0.29
7 0.29
8 0.3
9 0.31
10 0.34
11 0.31
12 0.31
13 0.31
14 0.31
15 0.27
16 0.27
17 0.24
18 0.19
19 0.16
20 0.12
21 0.11
22 0.1
23 0.09
24 0.06
25 0.04
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.04
37 0.05
38 0.07
39 0.08
40 0.1
41 0.13
42 0.21
43 0.25
44 0.32
45 0.41
46 0.5
47 0.57
48 0.61
49 0.64
50 0.61
51 0.6
52 0.61
53 0.61
54 0.6
55 0.57
56 0.58
57 0.59
58 0.59
59 0.64
60 0.65
61 0.67
62 0.68
63 0.74
64 0.78
65 0.81
66 0.83
67 0.81
68 0.76
69 0.7
70 0.66
71 0.6
72 0.53