Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BW45

Protein Details
Accession A0A0D2BW45    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
301-323VYEFWAKKIRPRMKNPKKRELMAHydrophilic
NLS Segment(s)
PositionSequence
307-319KKIRPRMKNPKKR
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 7.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR020946  Flavin_mOase-like  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004499  F:N,N-dimethylaniline monooxygenase activity  
GO:0050661  F:NADP binding  
Pfam View protein in Pfam  
PF00743  FMO-like  
Amino Acid Sequences MAQTNGTADDIVHCDALIIGAGFSGMSMLYRLRKLGLKAKIFESGNDFGGVWYWNRYPGARVDSEWPYYQLNIPEVYRNWEFTEKFPGHKEIRAYCAHADKVLGLRKDVYFNAHVVDAQWSESDQKWTVKTDQGHTSVSKYLILCTGLLHRRHVPDFPGLANFKGVIHHTGFWPEDMSCKGKKVALIGAGATAVQVVQEVAKEADQLTVFIRRPSLCLPMGQRKLSADEQKGWKGYFDALFREGRKSRAGFPGKGPDNGVFDVSDEEREEYFEELWARGGFNFMIFNYNNVVLDKEANQKVYEFWAKKIRPRMKNPKKRELMAPMKAPYYFATKRNPLEQDYYERLDQDNVEIINIIDNPMKTFNETGILMEDGTQLDFDVVILATGFDSFSGSVTKMGLKNKDGVDIKDIWKDGIRTYLGMTFNGFPNTFMVYTSHAPTALSNGPTIIEAQADFVISAIEKMEKEGAKTIEPSKEAEEEWDVMIDAMNKPTLFPLTDSWWNATNIPGKKPQMLTHVGGIEMYEEQCKATLGDWKGFTLVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.09
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.04
11 0.04
12 0.03
13 0.03
14 0.05
15 0.08
16 0.13
17 0.15
18 0.16
19 0.19
20 0.24
21 0.29
22 0.37
23 0.44
24 0.46
25 0.49
26 0.5
27 0.55
28 0.51
29 0.47
30 0.45
31 0.38
32 0.32
33 0.3
34 0.27
35 0.19
36 0.2
37 0.19
38 0.14
39 0.15
40 0.15
41 0.17
42 0.19
43 0.2
44 0.21
45 0.26
46 0.32
47 0.29
48 0.3
49 0.33
50 0.36
51 0.39
52 0.37
53 0.33
54 0.28
55 0.28
56 0.29
57 0.27
58 0.24
59 0.23
60 0.23
61 0.26
62 0.26
63 0.31
64 0.29
65 0.28
66 0.29
67 0.33
68 0.33
69 0.3
70 0.39
71 0.35
72 0.37
73 0.38
74 0.42
75 0.39
76 0.41
77 0.45
78 0.39
79 0.43
80 0.42
81 0.42
82 0.38
83 0.41
84 0.37
85 0.32
86 0.28
87 0.25
88 0.28
89 0.31
90 0.28
91 0.24
92 0.26
93 0.26
94 0.29
95 0.28
96 0.26
97 0.22
98 0.21
99 0.21
100 0.19
101 0.17
102 0.15
103 0.17
104 0.13
105 0.11
106 0.11
107 0.1
108 0.13
109 0.14
110 0.17
111 0.17
112 0.2
113 0.21
114 0.25
115 0.28
116 0.31
117 0.34
118 0.35
119 0.39
120 0.39
121 0.4
122 0.37
123 0.36
124 0.33
125 0.3
126 0.27
127 0.21
128 0.19
129 0.18
130 0.17
131 0.15
132 0.13
133 0.2
134 0.23
135 0.24
136 0.27
137 0.29
138 0.33
139 0.35
140 0.36
141 0.31
142 0.3
143 0.3
144 0.28
145 0.29
146 0.26
147 0.24
148 0.23
149 0.2
150 0.15
151 0.15
152 0.15
153 0.13
154 0.13
155 0.14
156 0.14
157 0.17
158 0.17
159 0.16
160 0.16
161 0.13
162 0.13
163 0.15
164 0.18
165 0.16
166 0.18
167 0.19
168 0.19
169 0.2
170 0.2
171 0.21
172 0.2
173 0.19
174 0.17
175 0.16
176 0.14
177 0.13
178 0.1
179 0.07
180 0.04
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.05
189 0.06
190 0.06
191 0.08
192 0.08
193 0.08
194 0.09
195 0.14
196 0.14
197 0.14
198 0.17
199 0.15
200 0.17
201 0.19
202 0.22
203 0.18
204 0.2
205 0.25
206 0.32
207 0.37
208 0.35
209 0.34
210 0.3
211 0.34
212 0.36
213 0.37
214 0.3
215 0.31
216 0.34
217 0.36
218 0.37
219 0.33
220 0.28
221 0.22
222 0.22
223 0.19
224 0.17
225 0.16
226 0.16
227 0.19
228 0.2
229 0.25
230 0.24
231 0.23
232 0.26
233 0.25
234 0.27
235 0.34
236 0.38
237 0.34
238 0.36
239 0.43
240 0.4
241 0.4
242 0.37
243 0.29
244 0.27
245 0.25
246 0.22
247 0.13
248 0.11
249 0.12
250 0.11
251 0.1
252 0.07
253 0.08
254 0.08
255 0.08
256 0.09
257 0.08
258 0.08
259 0.08
260 0.09
261 0.08
262 0.09
263 0.08
264 0.08
265 0.07
266 0.08
267 0.06
268 0.06
269 0.06
270 0.05
271 0.09
272 0.08
273 0.09
274 0.1
275 0.1
276 0.1
277 0.1
278 0.1
279 0.07
280 0.08
281 0.1
282 0.16
283 0.17
284 0.17
285 0.17
286 0.17
287 0.17
288 0.21
289 0.25
290 0.2
291 0.22
292 0.3
293 0.32
294 0.36
295 0.46
296 0.52
297 0.53
298 0.63
299 0.71
300 0.73
301 0.82
302 0.86
303 0.86
304 0.83
305 0.77
306 0.72
307 0.71
308 0.69
309 0.63
310 0.59
311 0.51
312 0.46
313 0.43
314 0.38
315 0.29
316 0.28
317 0.25
318 0.24
319 0.29
320 0.34
321 0.36
322 0.41
323 0.43
324 0.37
325 0.39
326 0.38
327 0.38
328 0.36
329 0.37
330 0.32
331 0.3
332 0.27
333 0.24
334 0.21
335 0.15
336 0.14
337 0.11
338 0.11
339 0.1
340 0.09
341 0.09
342 0.09
343 0.09
344 0.08
345 0.08
346 0.1
347 0.12
348 0.12
349 0.12
350 0.12
351 0.12
352 0.13
353 0.13
354 0.12
355 0.11
356 0.11
357 0.1
358 0.1
359 0.1
360 0.08
361 0.08
362 0.07
363 0.05
364 0.05
365 0.05
366 0.04
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.04
373 0.04
374 0.04
375 0.03
376 0.04
377 0.04
378 0.05
379 0.06
380 0.07
381 0.07
382 0.08
383 0.12
384 0.15
385 0.21
386 0.24
387 0.25
388 0.3
389 0.3
390 0.37
391 0.35
392 0.33
393 0.32
394 0.33
395 0.33
396 0.32
397 0.32
398 0.25
399 0.25
400 0.25
401 0.21
402 0.23
403 0.21
404 0.17
405 0.18
406 0.23
407 0.21
408 0.21
409 0.22
410 0.18
411 0.19
412 0.22
413 0.2
414 0.15
415 0.16
416 0.18
417 0.16
418 0.15
419 0.14
420 0.15
421 0.18
422 0.2
423 0.19
424 0.16
425 0.16
426 0.16
427 0.2
428 0.2
429 0.18
430 0.16
431 0.15
432 0.16
433 0.16
434 0.16
435 0.12
436 0.08
437 0.07
438 0.09
439 0.09
440 0.08
441 0.08
442 0.07
443 0.07
444 0.06
445 0.06
446 0.06
447 0.08
448 0.07
449 0.09
450 0.15
451 0.16
452 0.18
453 0.23
454 0.24
455 0.25
456 0.29
457 0.32
458 0.32
459 0.33
460 0.33
461 0.3
462 0.31
463 0.29
464 0.28
465 0.26
466 0.22
467 0.21
468 0.19
469 0.16
470 0.14
471 0.14
472 0.13
473 0.12
474 0.12
475 0.14
476 0.13
477 0.13
478 0.15
479 0.16
480 0.15
481 0.16
482 0.18
483 0.22
484 0.29
485 0.31
486 0.32
487 0.33
488 0.34
489 0.32
490 0.33
491 0.35
492 0.33
493 0.36
494 0.42
495 0.41
496 0.47
497 0.5
498 0.49
499 0.49
500 0.51
501 0.48
502 0.45
503 0.43
504 0.37
505 0.33
506 0.28
507 0.21
508 0.17
509 0.16
510 0.12
511 0.11
512 0.11
513 0.12
514 0.12
515 0.11
516 0.12
517 0.19
518 0.22
519 0.28
520 0.29
521 0.29