Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2AM30

Protein Details
Accession A0A0D2AM30    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
232-254KITPQEKKETKKDVKVRLRRELLBasic
NLS Segment(s)
PositionSequence
224-251LRRERKGSKITPQEKKETKKDVKVRLRR
274-280RRRKRAG
Subcellular Location(s) mito 14.5, cyto_mito 10, nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MVKPSPQLCARLRFTTKQVGRGFYRGNRAGAMGAHTEFGRYVIDWRKTVHYNMPEMKDFPLTPFVTMEMEPKSRAEDRPDGTTYVPSRIDALEFLRTWKKINPLEYDGIVAHQEEERRRFAAATAEQNHEETQEQEQGQEQERAQQEAERWAREQAQQRPQKRIQKQVQQQTRSIHTTRRLRTPAQAPVVPEQPDQPGKEWNQMSRAERKGLVNKATTSELRQLRRERKGSKITPQEKKETKKDVKVRLRRELLGKGLFQDEKELQKLLTEEGRRRKRAGLPRATDEEKGRFLDGLQHKTEAKGLFDKIFGGGRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.6
4 0.6
5 0.59
6 0.56
7 0.54
8 0.56
9 0.57
10 0.52
11 0.58
12 0.53
13 0.5
14 0.44
15 0.41
16 0.36
17 0.3
18 0.27
19 0.2
20 0.17
21 0.16
22 0.15
23 0.15
24 0.13
25 0.13
26 0.11
27 0.09
28 0.14
29 0.22
30 0.27
31 0.28
32 0.31
33 0.36
34 0.38
35 0.41
36 0.44
37 0.4
38 0.43
39 0.49
40 0.5
41 0.47
42 0.45
43 0.43
44 0.38
45 0.33
46 0.28
47 0.28
48 0.24
49 0.23
50 0.22
51 0.21
52 0.2
53 0.2
54 0.2
55 0.17
56 0.18
57 0.18
58 0.18
59 0.21
60 0.22
61 0.25
62 0.28
63 0.32
64 0.33
65 0.38
66 0.39
67 0.36
68 0.34
69 0.37
70 0.32
71 0.28
72 0.26
73 0.21
74 0.2
75 0.19
76 0.19
77 0.14
78 0.15
79 0.15
80 0.14
81 0.18
82 0.21
83 0.21
84 0.23
85 0.25
86 0.31
87 0.31
88 0.37
89 0.39
90 0.39
91 0.41
92 0.39
93 0.37
94 0.28
95 0.24
96 0.2
97 0.14
98 0.1
99 0.09
100 0.12
101 0.14
102 0.17
103 0.19
104 0.19
105 0.19
106 0.19
107 0.18
108 0.22
109 0.22
110 0.26
111 0.28
112 0.3
113 0.3
114 0.31
115 0.3
116 0.23
117 0.2
118 0.14
119 0.13
120 0.14
121 0.14
122 0.13
123 0.15
124 0.16
125 0.18
126 0.19
127 0.17
128 0.19
129 0.2
130 0.21
131 0.19
132 0.18
133 0.17
134 0.23
135 0.25
136 0.2
137 0.2
138 0.21
139 0.23
140 0.26
141 0.33
142 0.32
143 0.4
144 0.46
145 0.49
146 0.55
147 0.6
148 0.65
149 0.63
150 0.65
151 0.64
152 0.66
153 0.71
154 0.73
155 0.74
156 0.68
157 0.67
158 0.59
159 0.55
160 0.5
161 0.44
162 0.39
163 0.38
164 0.44
165 0.43
166 0.48
167 0.47
168 0.45
169 0.49
170 0.5
171 0.48
172 0.44
173 0.43
174 0.36
175 0.36
176 0.38
177 0.33
178 0.28
179 0.22
180 0.22
181 0.23
182 0.23
183 0.21
184 0.23
185 0.23
186 0.3
187 0.31
188 0.29
189 0.3
190 0.33
191 0.36
192 0.38
193 0.39
194 0.34
195 0.35
196 0.38
197 0.4
198 0.41
199 0.42
200 0.37
201 0.35
202 0.35
203 0.35
204 0.32
205 0.28
206 0.3
207 0.32
208 0.34
209 0.4
210 0.47
211 0.52
212 0.6
213 0.66
214 0.62
215 0.65
216 0.71
217 0.7
218 0.7
219 0.72
220 0.73
221 0.74
222 0.75
223 0.76
224 0.74
225 0.76
226 0.75
227 0.74
228 0.73
229 0.73
230 0.77
231 0.78
232 0.8
233 0.82
234 0.82
235 0.81
236 0.79
237 0.73
238 0.69
239 0.64
240 0.6
241 0.54
242 0.47
243 0.38
244 0.38
245 0.35
246 0.29
247 0.29
248 0.26
249 0.26
250 0.27
251 0.26
252 0.21
253 0.23
254 0.23
255 0.21
256 0.25
257 0.27
258 0.33
259 0.43
260 0.53
261 0.55
262 0.57
263 0.61
264 0.63
265 0.67
266 0.7
267 0.7
268 0.67
269 0.7
270 0.74
271 0.71
272 0.65
273 0.6
274 0.54
275 0.48
276 0.43
277 0.37
278 0.29
279 0.27
280 0.32
281 0.35
282 0.37
283 0.35
284 0.37
285 0.36
286 0.37
287 0.42
288 0.34
289 0.31
290 0.3
291 0.31
292 0.29
293 0.29
294 0.29
295 0.26