Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2C592

Protein Details
Accession A0A0D2C592    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-124QALKDLRPAQPRRTRRRPRABasic
NLS Segment(s)
PositionSequence
112-124PAQPRRTRRRPRA
Subcellular Location(s) cyto_nucl 8.333, cyto 8, nucl 7.5, mito 7, cyto_pero 6.833, pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015034  Bles03  
IPR023398  TIF_eIF4e-like  
Pfam View protein in Pfam  
PF08939  DUF1917  
Amino Acid Sequences MLRPDRLQPEADIRELATSQRVTAGKWMLVPREEEVDSVWAVVARAVWEGKLGTAAKVATAKAEEGMMVVDDDGGGSGTRDRGLRLICIYTGDFSDQADVKRVLQALKDLRPAQPRRTRRRPRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.23
4 0.18
5 0.15
6 0.14
7 0.19
8 0.19
9 0.18
10 0.23
11 0.24
12 0.2
13 0.24
14 0.27
15 0.23
16 0.24
17 0.26
18 0.22
19 0.23
20 0.22
21 0.18
22 0.17
23 0.16
24 0.14
25 0.12
26 0.11
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.06
38 0.09
39 0.08
40 0.08
41 0.09
42 0.09
43 0.09
44 0.1
45 0.1
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.06
67 0.07
68 0.07
69 0.1
70 0.11
71 0.13
72 0.14
73 0.15
74 0.13
75 0.15
76 0.15
77 0.13
78 0.13
79 0.12
80 0.11
81 0.1
82 0.13
83 0.12
84 0.13
85 0.16
86 0.17
87 0.16
88 0.19
89 0.2
90 0.19
91 0.18
92 0.25
93 0.27
94 0.31
95 0.37
96 0.37
97 0.41
98 0.5
99 0.54
100 0.57
101 0.61
102 0.67
103 0.7
104 0.8