Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2DEU6

Protein Details
Accession A0A0D2DEU6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
92-111DEKAWRKKPFWPQQFVKKTVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 8.666, nucl 8.5, mito 8.5, cyto_nucl 8.333, cyto_mito 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039294  EIF1AD  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01176  eIF-1a  
Amino Acid Sequences MSRRKIRNTAEETLTPPDSLAPGQLIARVVKTNGKDLYTVQAPDSSTFLVELEARFRSTIFVKRGGYVLVDTTTTADRDNKIQGEIVNIVGDEKAWRKKPFWPQQFVKKTVSADTAALGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.36
3 0.29
4 0.23
5 0.19
6 0.16
7 0.14
8 0.09
9 0.09
10 0.09
11 0.11
12 0.12
13 0.11
14 0.12
15 0.12
16 0.13
17 0.16
18 0.17
19 0.22
20 0.22
21 0.22
22 0.22
23 0.22
24 0.25
25 0.23
26 0.22
27 0.17
28 0.18
29 0.17
30 0.17
31 0.17
32 0.12
33 0.1
34 0.09
35 0.09
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.09
42 0.08
43 0.08
44 0.09
45 0.11
46 0.17
47 0.17
48 0.21
49 0.22
50 0.22
51 0.23
52 0.21
53 0.19
54 0.13
55 0.12
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.12
66 0.16
67 0.16
68 0.16
69 0.17
70 0.16
71 0.17
72 0.17
73 0.15
74 0.12
75 0.11
76 0.11
77 0.09
78 0.09
79 0.08
80 0.12
81 0.19
82 0.26
83 0.29
84 0.31
85 0.4
86 0.51
87 0.6
88 0.64
89 0.67
90 0.68
91 0.76
92 0.83
93 0.8
94 0.73
95 0.67
96 0.59
97 0.53
98 0.48
99 0.39
100 0.31