Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2CTH4

Protein Details
Accession A0A0D2CTH4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-37EYNKRRAAWKASEKRRKQEEKLBasic
NLS Segment(s)
PositionSequence
19-51KRRAAWKASEKRRKQEEKLLKEQAKRDRKAALK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSVSPYSVQHDFEVQEYNKRRAAWKASEKRRKQEEKLLKEQAKRDRKAALKQLAQAERAEPRKTFGWLCRKSQSRTDVSAAKKLDDDDDDSDSDEIPLRAALAAYPPELRRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.31
3 0.34
4 0.37
5 0.38
6 0.38
7 0.4
8 0.4
9 0.46
10 0.47
11 0.53
12 0.6
13 0.67
14 0.76
15 0.8
16 0.82
17 0.85
18 0.83
19 0.78
20 0.78
21 0.78
22 0.75
23 0.78
24 0.78
25 0.73
26 0.69
27 0.71
28 0.7
29 0.69
30 0.62
31 0.56
32 0.53
33 0.53
34 0.55
35 0.57
36 0.55
37 0.48
38 0.49
39 0.54
40 0.48
41 0.44
42 0.37
43 0.29
44 0.27
45 0.28
46 0.26
47 0.19
48 0.2
49 0.2
50 0.22
51 0.23
52 0.25
53 0.33
54 0.35
55 0.39
56 0.45
57 0.49
58 0.5
59 0.54
60 0.54
61 0.48
62 0.48
63 0.47
64 0.46
65 0.43
66 0.47
67 0.4
68 0.34
69 0.31
70 0.27
71 0.26
72 0.21
73 0.22
74 0.18
75 0.2
76 0.19
77 0.2
78 0.19
79 0.17
80 0.16
81 0.14
82 0.11
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.07
89 0.09
90 0.11
91 0.12
92 0.16
93 0.18