Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WAB6

Protein Details
Accession B2WAB6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
209-239KEGEKEKGGNGRRRNRRGGRRHGNKGKEGVKBasic
NLS Segment(s)
PositionSequence
209-238KEGEKEKGGNGRRRNRRGGRRHGNKGKEGV
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MAIKSEPGLRQTATPSPSPPRPARYAPATNAAPIAGSSNSLSSSVYATPTASTGLSQFQLDCLESRKRLFADDDDDDTNNNQAIKIEGRPIKRIRYHLHTTPIKPSEEPPKPQLPEIPNPRDPRVDLLQVCAAKGNFTPYELEKYKAVQPKVDSVVYQKAMALFNLLQDLESRFGNDPPKCYPLSSAQKERIAKLQRIMDTGVIPPPEKEGEKEKGGNGRRRNRRGGRRHGNKGKEGVKTEPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.38
4 0.44
5 0.49
6 0.51
7 0.51
8 0.54
9 0.57
10 0.59
11 0.59
12 0.6
13 0.55
14 0.57
15 0.52
16 0.46
17 0.41
18 0.34
19 0.25
20 0.19
21 0.17
22 0.09
23 0.1
24 0.09
25 0.1
26 0.1
27 0.1
28 0.11
29 0.09
30 0.11
31 0.1
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.09
39 0.09
40 0.08
41 0.1
42 0.11
43 0.11
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.14
50 0.18
51 0.2
52 0.21
53 0.24
54 0.23
55 0.25
56 0.26
57 0.25
58 0.26
59 0.27
60 0.29
61 0.27
62 0.27
63 0.25
64 0.23
65 0.21
66 0.15
67 0.13
68 0.09
69 0.08
70 0.09
71 0.1
72 0.11
73 0.17
74 0.21
75 0.23
76 0.3
77 0.33
78 0.39
79 0.42
80 0.47
81 0.45
82 0.48
83 0.52
84 0.5
85 0.56
86 0.54
87 0.51
88 0.53
89 0.5
90 0.44
91 0.38
92 0.37
93 0.37
94 0.37
95 0.39
96 0.36
97 0.4
98 0.4
99 0.4
100 0.42
101 0.37
102 0.4
103 0.45
104 0.46
105 0.45
106 0.48
107 0.49
108 0.44
109 0.4
110 0.36
111 0.3
112 0.29
113 0.23
114 0.21
115 0.23
116 0.22
117 0.22
118 0.19
119 0.16
120 0.12
121 0.12
122 0.13
123 0.1
124 0.1
125 0.12
126 0.12
127 0.19
128 0.19
129 0.21
130 0.18
131 0.2
132 0.26
133 0.3
134 0.3
135 0.26
136 0.27
137 0.3
138 0.33
139 0.31
140 0.25
141 0.23
142 0.28
143 0.25
144 0.24
145 0.19
146 0.18
147 0.18
148 0.17
149 0.16
150 0.1
151 0.1
152 0.11
153 0.1
154 0.08
155 0.09
156 0.1
157 0.09
158 0.09
159 0.11
160 0.11
161 0.14
162 0.22
163 0.22
164 0.24
165 0.27
166 0.3
167 0.29
168 0.29
169 0.29
170 0.31
171 0.4
172 0.44
173 0.48
174 0.51
175 0.57
176 0.59
177 0.57
178 0.57
179 0.53
180 0.49
181 0.47
182 0.48
183 0.43
184 0.43
185 0.42
186 0.35
187 0.3
188 0.27
189 0.25
190 0.2
191 0.19
192 0.17
193 0.18
194 0.2
195 0.2
196 0.22
197 0.25
198 0.29
199 0.34
200 0.37
201 0.38
202 0.43
203 0.51
204 0.56
205 0.59
206 0.64
207 0.7
208 0.75
209 0.82
210 0.84
211 0.86
212 0.88
213 0.89
214 0.9
215 0.89
216 0.93
217 0.92
218 0.9
219 0.86
220 0.84
221 0.8
222 0.76
223 0.7
224 0.65