Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2W7M8

Protein Details
Accession B2W7M8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-58GPPYRPLKKHTRKATMKLREBasic
NLS Segment(s)
PositionSequence
44-64PLKKHTRKATMKLREDKKSHP
Subcellular Location(s) mito 11, nucl 8, cyto_nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MDLRSEGHAQVAVSMSLLVGPLAHYRFYPRYETQVEILGPPYRPLKKHTRKATMKLREDKKSHPLKIRSTSPIRDVGETGIYFRPQPTLSKPRTWLPAEKPHKSPVASTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.07
5 0.05
6 0.04
7 0.05
8 0.08
9 0.09
10 0.1
11 0.1
12 0.16
13 0.19
14 0.22
15 0.27
16 0.25
17 0.31
18 0.33
19 0.35
20 0.31
21 0.31
22 0.29
23 0.23
24 0.23
25 0.19
26 0.16
27 0.16
28 0.21
29 0.2
30 0.21
31 0.26
32 0.35
33 0.43
34 0.52
35 0.6
36 0.65
37 0.68
38 0.76
39 0.81
40 0.79
41 0.77
42 0.77
43 0.74
44 0.71
45 0.68
46 0.63
47 0.62
48 0.61
49 0.59
50 0.59
51 0.58
52 0.57
53 0.61
54 0.62
55 0.6
56 0.56
57 0.53
58 0.48
59 0.49
60 0.43
61 0.38
62 0.33
63 0.27
64 0.25
65 0.22
66 0.22
67 0.16
68 0.16
69 0.15
70 0.15
71 0.17
72 0.14
73 0.18
74 0.24
75 0.32
76 0.37
77 0.43
78 0.46
79 0.49
80 0.56
81 0.57
82 0.56
83 0.54
84 0.6
85 0.63
86 0.65
87 0.64
88 0.62
89 0.63
90 0.57