Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2VU63

Protein Details
Accession B2VU63    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-47GSYANKKRAIRKNTSFHRPKTHydrophilic
NLS Segment(s)
PositionSequence
22-58KAALRGSYANKKRAIRKNTSFHRPKTLELSRAGKYPR
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR005633  Ribosomal_L23/L25_N  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
PF03939  Ribosomal_L23eN  
Amino Acid Sequences MGPKPASKTATKTGKQANAAAKAALRGSYANKKRAIRKNTSFHRPKTLELSRAGKYPRKSVPHAPRMDAEKVLIHPLNTESAMKKIEENNTLVFICNVKANKRQIAAALKKQYDVSCVKINTLIRPDGSKKAFCRLTADVDALDIAATKLAIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.6
4 0.57
5 0.52
6 0.51
7 0.44
8 0.37
9 0.31
10 0.29
11 0.23
12 0.17
13 0.13
14 0.18
15 0.27
16 0.33
17 0.38
18 0.44
19 0.49
20 0.58
21 0.66
22 0.69
23 0.68
24 0.71
25 0.75
26 0.77
27 0.82
28 0.8
29 0.74
30 0.76
31 0.68
32 0.61
33 0.6
34 0.56
35 0.5
36 0.47
37 0.48
38 0.39
39 0.41
40 0.43
41 0.39
42 0.36
43 0.38
44 0.4
45 0.41
46 0.44
47 0.5
48 0.57
49 0.61
50 0.61
51 0.56
52 0.52
53 0.51
54 0.48
55 0.38
56 0.28
57 0.2
58 0.18
59 0.19
60 0.17
61 0.12
62 0.11
63 0.11
64 0.11
65 0.1
66 0.11
67 0.08
68 0.1
69 0.11
70 0.1
71 0.12
72 0.14
73 0.18
74 0.19
75 0.2
76 0.19
77 0.2
78 0.2
79 0.18
80 0.15
81 0.12
82 0.1
83 0.12
84 0.13
85 0.14
86 0.21
87 0.25
88 0.29
89 0.29
90 0.29
91 0.31
92 0.39
93 0.42
94 0.44
95 0.47
96 0.43
97 0.43
98 0.45
99 0.4
100 0.36
101 0.32
102 0.28
103 0.28
104 0.28
105 0.27
106 0.3
107 0.31
108 0.31
109 0.32
110 0.3
111 0.25
112 0.29
113 0.32
114 0.36
115 0.39
116 0.4
117 0.38
118 0.45
119 0.47
120 0.43
121 0.46
122 0.41
123 0.44
124 0.4
125 0.4
126 0.3
127 0.27
128 0.26
129 0.19
130 0.16
131 0.09
132 0.06
133 0.05