Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WMC7

Protein Details
Accession B2WMC7   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29TSAGSRHTRSRVRSKRRLLRHTAQQLKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12, cyto 3.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MTSAGSRHTRSRVRSKRRLLRHTAQQLKPGCQTPNMAGPAQSLNSWSGKLNRRKLSVMSVVEVTNEGSQRLRAARAFLRGASGVEGRGFGVFGAPLPLTYFLKASLMLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.84
4 0.88
5 0.89
6 0.87
7 0.85
8 0.85
9 0.85
10 0.84
11 0.77
12 0.74
13 0.69
14 0.63
15 0.58
16 0.52
17 0.42
18 0.34
19 0.33
20 0.28
21 0.31
22 0.29
23 0.26
24 0.22
25 0.21
26 0.21
27 0.19
28 0.17
29 0.11
30 0.1
31 0.11
32 0.11
33 0.11
34 0.16
35 0.24
36 0.32
37 0.4
38 0.43
39 0.45
40 0.46
41 0.46
42 0.44
43 0.42
44 0.34
45 0.27
46 0.24
47 0.21
48 0.19
49 0.18
50 0.14
51 0.1
52 0.09
53 0.08
54 0.07
55 0.08
56 0.1
57 0.11
58 0.12
59 0.11
60 0.15
61 0.17
62 0.22
63 0.23
64 0.21
65 0.22
66 0.2
67 0.2
68 0.18
69 0.16
70 0.12
71 0.11
72 0.11
73 0.1
74 0.09
75 0.09
76 0.06
77 0.06
78 0.05
79 0.05
80 0.08
81 0.07
82 0.07
83 0.09
84 0.12
85 0.13
86 0.14
87 0.15
88 0.13
89 0.14