Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VUS1

Protein Details
Accession B2VUS1   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-96VRWANGNKTTRKRRSKCAGADTVSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, nucl 4, mito 3
Family & Domain DBs
Amino Acid Sequences MQQVDSENLSVDPYKSIPRSCPYLTCIIYIAKPCVYVNTMPPSPSCPFLHVARLPALIIGKGPSGPALPAAAVRWANGNKTTRKRRSKCAGADTVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.26
5 0.29
6 0.35
7 0.35
8 0.37
9 0.34
10 0.38
11 0.37
12 0.33
13 0.31
14 0.25
15 0.26
16 0.25
17 0.23
18 0.16
19 0.16
20 0.15
21 0.15
22 0.16
23 0.14
24 0.16
25 0.2
26 0.2
27 0.2
28 0.2
29 0.23
30 0.22
31 0.25
32 0.21
33 0.17
34 0.19
35 0.2
36 0.25
37 0.21
38 0.22
39 0.19
40 0.19
41 0.17
42 0.15
43 0.14
44 0.09
45 0.08
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.11
59 0.1
60 0.11
61 0.15
62 0.16
63 0.19
64 0.24
65 0.3
66 0.35
67 0.45
68 0.56
69 0.61
70 0.71
71 0.75
72 0.8
73 0.84
74 0.85
75 0.84
76 0.83