Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SAD9

Protein Details
Accession A0A0L0SAD9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-106LAEESKSGRKQRKERKNRAKKVRGTKKAAIMGKBasic
NLS Segment(s)
PositionSequence
75-107AEESKSGRKQRKERKNRAKKVRGTKKAAIMGKK
Subcellular Location(s) cyto 11.5, mito 10, cyto_nucl 9, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDVLHANLANLAKETIREKLAKMYKVNKDVVVVFGFRTAFGGGKSTGFALIYDSVDSLKKFEPKHRLVRLGLAEESKSGRKQRKERKNRAKKVRGTKKAAIMGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.15
4 0.15
5 0.19
6 0.2
7 0.2
8 0.29
9 0.35
10 0.38
11 0.42
12 0.48
13 0.51
14 0.56
15 0.57
16 0.48
17 0.43
18 0.39
19 0.35
20 0.27
21 0.2
22 0.14
23 0.14
24 0.13
25 0.11
26 0.11
27 0.09
28 0.08
29 0.08
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.1
48 0.14
49 0.16
50 0.23
51 0.32
52 0.38
53 0.48
54 0.51
55 0.54
56 0.5
57 0.55
58 0.5
59 0.44
60 0.39
61 0.3
62 0.25
63 0.21
64 0.23
65 0.2
66 0.22
67 0.26
68 0.33
69 0.42
70 0.52
71 0.62
72 0.71
73 0.79
74 0.86
75 0.9
76 0.93
77 0.95
78 0.95
79 0.95
80 0.93
81 0.93
82 0.93
83 0.92
84 0.89
85 0.86
86 0.83
87 0.81