Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0S953

Protein Details
Accession A0A0L0S953    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNRRGRHARSRSPRRTSTKDGGTBasic
NLS Segment(s)
PositionSequence
5-14GRHARSRSPR
Subcellular Location(s) plas 19, mito 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029164  PIG-Y  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15159  PIG-Y  
Amino Acid Sequences MNRRGRHARSRSPRRTSTKDGGTGKTSDMKPIHDLHARIIDDSLFSPLPPMVVVALSVLGAAAFLYAAIISKLLPSTGIWWLDAIRNDWYYCFLIPLTAPVSIFFLIWNWYGKKLFRHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.81
5 0.77
6 0.75
7 0.71
8 0.65
9 0.59
10 0.52
11 0.45
12 0.44
13 0.36
14 0.34
15 0.31
16 0.29
17 0.3
18 0.31
19 0.34
20 0.31
21 0.31
22 0.27
23 0.33
24 0.3
25 0.27
26 0.25
27 0.2
28 0.16
29 0.16
30 0.15
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.01
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.07
64 0.1
65 0.11
66 0.1
67 0.11
68 0.12
69 0.14
70 0.15
71 0.15
72 0.15
73 0.16
74 0.16
75 0.16
76 0.18
77 0.17
78 0.16
79 0.15
80 0.12
81 0.11
82 0.11
83 0.14
84 0.12
85 0.11
86 0.11
87 0.11
88 0.13
89 0.13
90 0.12
91 0.1
92 0.09
93 0.11
94 0.12
95 0.17
96 0.16
97 0.2
98 0.23
99 0.26