Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SN48

Protein Details
Accession A0A0L0SN48   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-107LDDPPPSTTPPPRRKRRPRRGDLLLFVVHydrophilic
NLS Segment(s)
PositionSequence
90-99PPRRKRRPRR
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, nucl 8.5, mito 7
Family & Domain DBs
Amino Acid Sequences MFALVPSLSPTPSPTTAMTDLGAPVAAAVAAASSVGSSGMSATTSNFPDPTVEDVPDSGENSQQGQTDVTIEPSADAMDLDDPPPSTTPPPRRKRRPRRGDLLLFVVHGMGPARLVAAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.26
4 0.27
5 0.24
6 0.2
7 0.18
8 0.16
9 0.14
10 0.08
11 0.06
12 0.05
13 0.04
14 0.03
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.06
30 0.08
31 0.09
32 0.1
33 0.1
34 0.1
35 0.1
36 0.11
37 0.15
38 0.14
39 0.13
40 0.13
41 0.13
42 0.14
43 0.14
44 0.13
45 0.08
46 0.08
47 0.08
48 0.09
49 0.1
50 0.09
51 0.09
52 0.09
53 0.08
54 0.1
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.05
63 0.05
64 0.04
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.08
71 0.09
72 0.1
73 0.13
74 0.21
75 0.32
76 0.42
77 0.52
78 0.62
79 0.73
80 0.83
81 0.9
82 0.93
83 0.94
84 0.93
85 0.93
86 0.92
87 0.89
88 0.82
89 0.77
90 0.66
91 0.55
92 0.45
93 0.35
94 0.25
95 0.17
96 0.13
97 0.07
98 0.06
99 0.06
100 0.07