Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0S0U7

Protein Details
Accession A0A0L0S0U7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
186-212IAETPKPPKPTKRPKTKTNPPPPPADAHydrophilic
NLS Segment(s)
PositionSequence
191-202KPPKPTKRPKTK
Subcellular Location(s) nucl 17, cyto_nucl 11.333, mito 5.5, cyto_mito 5.166, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MKTCTTPRLDTTRHNQLRHCPDLLQHNETMDNAPPPAAPAPPATADDARNADADAAAPGTTAATGAPPLIAQPPPPHLAAVHKFWSTQMQQLEHGDIDFKHHPLPLARIKKVMKSDPEVRQMVSSEAPLIFSKACEVFIAELTLRAWMVAEENKRRTLQRSDVATAVSKSDQYDFLIDIVPREEAIAETPKPPKPTKRPKTKTNPPPPPADAGLPAMAAGSSVTFIDPATGALFNPAMMPPQPGVPMQAMPHMHQVAVHPSFAPHHHHAPGTGHAHAHTLHQSGFASAAPPPPPSANVRMVPMHTQQPQPQPPAPVQHFVPGPNGTMVPVAVPQGQFAMPPPPHAPTHQFRPHAHAQNPHALPIGLGMPVPGTTPGMVPMPGATPGMVPAPLPQVPSQQQQQQRPPQQQGNQHAAQQSQPPPPTFQMLPGPSLQHQQQPQLPAQPQQLQQPQAQVQKQAQQPQVQVPQTQAQQQPQVQAPQPQAPQKQPQLQLQQQHLQQPQQVQQPQRQPHFHQQMQMPMPPAGMVQHQQQHQPPQFAALPYQSMGHPPQPRLPTQYQQAVQLPYQHAAAHAVHHANASPQIHHLHQLPPTAPHAAQQQQQQQQHLQQPVHGLQPQPPGAPLYQMHPSAAPPASLPPPTQQQVQLPMGVTVVPSASEPAAAPTFPGANLPAQPSALHGAGAPVHTSAPSVSLASTAPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.67
4 0.71
5 0.68
6 0.62
7 0.52
8 0.49
9 0.55
10 0.57
11 0.51
12 0.43
13 0.39
14 0.38
15 0.38
16 0.35
17 0.28
18 0.23
19 0.19
20 0.18
21 0.16
22 0.18
23 0.18
24 0.17
25 0.15
26 0.16
27 0.19
28 0.2
29 0.22
30 0.23
31 0.25
32 0.25
33 0.28
34 0.29
35 0.27
36 0.25
37 0.23
38 0.19
39 0.16
40 0.15
41 0.11
42 0.09
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.05
55 0.07
56 0.1
57 0.11
58 0.13
59 0.17
60 0.22
61 0.24
62 0.25
63 0.24
64 0.22
65 0.3
66 0.32
67 0.34
68 0.34
69 0.32
70 0.31
71 0.32
72 0.38
73 0.31
74 0.33
75 0.32
76 0.3
77 0.33
78 0.34
79 0.36
80 0.28
81 0.27
82 0.23
83 0.17
84 0.22
85 0.21
86 0.2
87 0.2
88 0.21
89 0.23
90 0.24
91 0.32
92 0.35
93 0.42
94 0.42
95 0.48
96 0.5
97 0.53
98 0.58
99 0.57
100 0.54
101 0.53
102 0.6
103 0.6
104 0.65
105 0.6
106 0.54
107 0.48
108 0.42
109 0.37
110 0.29
111 0.22
112 0.16
113 0.15
114 0.16
115 0.14
116 0.15
117 0.12
118 0.11
119 0.14
120 0.12
121 0.13
122 0.11
123 0.12
124 0.12
125 0.12
126 0.14
127 0.11
128 0.12
129 0.11
130 0.12
131 0.1
132 0.09
133 0.08
134 0.06
135 0.08
136 0.13
137 0.2
138 0.28
139 0.31
140 0.35
141 0.38
142 0.4
143 0.43
144 0.45
145 0.45
146 0.45
147 0.48
148 0.47
149 0.45
150 0.45
151 0.41
152 0.34
153 0.28
154 0.21
155 0.16
156 0.15
157 0.15
158 0.15
159 0.14
160 0.15
161 0.13
162 0.13
163 0.15
164 0.14
165 0.13
166 0.13
167 0.12
168 0.1
169 0.1
170 0.09
171 0.06
172 0.09
173 0.13
174 0.13
175 0.17
176 0.22
177 0.26
178 0.31
179 0.36
180 0.43
181 0.5
182 0.6
183 0.67
184 0.73
185 0.78
186 0.84
187 0.89
188 0.9
189 0.91
190 0.9
191 0.91
192 0.82
193 0.81
194 0.73
195 0.66
196 0.57
197 0.47
198 0.37
199 0.28
200 0.25
201 0.18
202 0.15
203 0.11
204 0.08
205 0.07
206 0.05
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.05
216 0.06
217 0.06
218 0.06
219 0.07
220 0.07
221 0.06
222 0.07
223 0.07
224 0.07
225 0.07
226 0.09
227 0.08
228 0.09
229 0.1
230 0.1
231 0.12
232 0.11
233 0.12
234 0.11
235 0.16
236 0.16
237 0.16
238 0.2
239 0.19
240 0.18
241 0.17
242 0.18
243 0.2
244 0.2
245 0.19
246 0.14
247 0.14
248 0.16
249 0.17
250 0.22
251 0.19
252 0.22
253 0.23
254 0.23
255 0.25
256 0.25
257 0.28
258 0.25
259 0.22
260 0.19
261 0.17
262 0.18
263 0.17
264 0.17
265 0.14
266 0.12
267 0.11
268 0.12
269 0.12
270 0.11
271 0.11
272 0.09
273 0.08
274 0.07
275 0.1
276 0.1
277 0.11
278 0.12
279 0.11
280 0.13
281 0.16
282 0.2
283 0.21
284 0.21
285 0.23
286 0.23
287 0.24
288 0.25
289 0.24
290 0.24
291 0.23
292 0.25
293 0.27
294 0.35
295 0.38
296 0.39
297 0.39
298 0.36
299 0.35
300 0.39
301 0.36
302 0.3
303 0.27
304 0.26
305 0.25
306 0.23
307 0.25
308 0.18
309 0.16
310 0.14
311 0.14
312 0.11
313 0.1
314 0.09
315 0.06
316 0.06
317 0.06
318 0.07
319 0.07
320 0.06
321 0.07
322 0.07
323 0.07
324 0.07
325 0.13
326 0.11
327 0.14
328 0.15
329 0.16
330 0.17
331 0.19
332 0.24
333 0.21
334 0.3
335 0.35
336 0.38
337 0.36
338 0.42
339 0.48
340 0.5
341 0.49
342 0.46
343 0.42
344 0.46
345 0.46
346 0.4
347 0.32
348 0.25
349 0.22
350 0.17
351 0.15
352 0.06
353 0.06
354 0.05
355 0.04
356 0.05
357 0.05
358 0.04
359 0.04
360 0.04
361 0.04
362 0.05
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.06
369 0.06
370 0.05
371 0.05
372 0.05
373 0.06
374 0.06
375 0.05
376 0.05
377 0.08
378 0.09
379 0.11
380 0.11
381 0.15
382 0.17
383 0.21
384 0.23
385 0.27
386 0.33
387 0.38
388 0.46
389 0.51
390 0.56
391 0.59
392 0.62
393 0.62
394 0.61
395 0.61
396 0.59
397 0.57
398 0.5
399 0.47
400 0.43
401 0.37
402 0.32
403 0.31
404 0.3
405 0.28
406 0.29
407 0.28
408 0.29
409 0.29
410 0.31
411 0.25
412 0.23
413 0.24
414 0.23
415 0.24
416 0.22
417 0.23
418 0.2
419 0.23
420 0.22
421 0.2
422 0.21
423 0.24
424 0.25
425 0.27
426 0.27
427 0.31
428 0.3
429 0.3
430 0.32
431 0.34
432 0.33
433 0.37
434 0.4
435 0.37
436 0.37
437 0.37
438 0.38
439 0.39
440 0.38
441 0.35
442 0.32
443 0.37
444 0.39
445 0.43
446 0.42
447 0.39
448 0.4
449 0.42
450 0.47
451 0.41
452 0.38
453 0.33
454 0.33
455 0.3
456 0.35
457 0.32
458 0.28
459 0.32
460 0.33
461 0.34
462 0.32
463 0.35
464 0.31
465 0.33
466 0.32
467 0.32
468 0.35
469 0.38
470 0.4
471 0.41
472 0.46
473 0.48
474 0.53
475 0.51
476 0.55
477 0.57
478 0.57
479 0.59
480 0.56
481 0.56
482 0.51
483 0.53
484 0.49
485 0.42
486 0.4
487 0.39
488 0.39
489 0.41
490 0.43
491 0.4
492 0.44
493 0.51
494 0.56
495 0.58
496 0.58
497 0.56
498 0.62
499 0.68
500 0.63
501 0.6
502 0.55
503 0.57
504 0.54
505 0.5
506 0.42
507 0.33
508 0.3
509 0.24
510 0.21
511 0.14
512 0.13
513 0.13
514 0.15
515 0.2
516 0.22
517 0.27
518 0.31
519 0.39
520 0.41
521 0.42
522 0.37
523 0.36
524 0.37
525 0.33
526 0.32
527 0.24
528 0.21
529 0.18
530 0.19
531 0.15
532 0.16
533 0.18
534 0.23
535 0.26
536 0.28
537 0.34
538 0.37
539 0.39
540 0.44
541 0.47
542 0.46
543 0.47
544 0.52
545 0.46
546 0.48
547 0.5
548 0.45
549 0.4
550 0.4
551 0.36
552 0.29
553 0.28
554 0.23
555 0.19
556 0.19
557 0.19
558 0.15
559 0.16
560 0.16
561 0.16
562 0.16
563 0.16
564 0.14
565 0.19
566 0.18
567 0.15
568 0.17
569 0.2
570 0.2
571 0.23
572 0.25
573 0.25
574 0.27
575 0.3
576 0.29
577 0.28
578 0.3
579 0.31
580 0.28
581 0.26
582 0.3
583 0.3
584 0.33
585 0.38
586 0.45
587 0.49
588 0.53
589 0.54
590 0.53
591 0.55
592 0.58
593 0.57
594 0.48
595 0.42
596 0.44
597 0.42
598 0.42
599 0.38
600 0.32
601 0.31
602 0.38
603 0.38
604 0.33
605 0.31
606 0.28
607 0.26
608 0.29
609 0.24
610 0.2
611 0.24
612 0.24
613 0.24
614 0.22
615 0.23
616 0.24
617 0.24
618 0.2
619 0.16
620 0.19
621 0.23
622 0.24
623 0.25
624 0.24
625 0.31
626 0.33
627 0.36
628 0.36
629 0.37
630 0.42
631 0.43
632 0.41
633 0.34
634 0.31
635 0.28
636 0.24
637 0.19
638 0.11
639 0.09
640 0.07
641 0.07
642 0.08
643 0.08
644 0.08
645 0.09
646 0.12
647 0.14
648 0.13
649 0.13
650 0.13
651 0.14
652 0.14
653 0.15
654 0.13
655 0.14
656 0.17
657 0.2
658 0.19
659 0.19
660 0.19
661 0.2
662 0.23
663 0.2
664 0.17
665 0.14
666 0.15
667 0.16
668 0.17
669 0.15
670 0.11
671 0.12
672 0.11
673 0.12
674 0.1
675 0.11
676 0.11
677 0.11
678 0.1
679 0.11