Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SJA7

Protein Details
Accession A0A0L0SJA7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-93VKSQTPKVDKQEKKKKKTGRAKKRLLYTRRFVBasic
NLS Segment(s)
PositionSequence
68-86KVDKQEKKKKKTGRAKKRL
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MDQPPPPPAPRRVPVPRTNDARILKFGRGNGSLTAIASSASSIYRSADRKLTPESPIAGNRVKSQTPKVDKQEKKKKKTGRAKKRLLYTRRFVNAVATFGGKRKMNPAPTEKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.71
4 0.69
5 0.68
6 0.67
7 0.62
8 0.56
9 0.54
10 0.49
11 0.45
12 0.41
13 0.39
14 0.35
15 0.32
16 0.3
17 0.25
18 0.24
19 0.21
20 0.18
21 0.17
22 0.12
23 0.1
24 0.08
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.07
31 0.11
32 0.13
33 0.14
34 0.19
35 0.19
36 0.21
37 0.26
38 0.27
39 0.25
40 0.24
41 0.24
42 0.22
43 0.22
44 0.23
45 0.21
46 0.19
47 0.2
48 0.22
49 0.21
50 0.22
51 0.25
52 0.3
53 0.35
54 0.41
55 0.46
56 0.54
57 0.59
58 0.68
59 0.75
60 0.76
61 0.78
62 0.8
63 0.81
64 0.82
65 0.86
66 0.87
67 0.87
68 0.87
69 0.89
70 0.87
71 0.88
72 0.87
73 0.84
74 0.81
75 0.77
76 0.75
77 0.69
78 0.64
79 0.54
80 0.52
81 0.45
82 0.39
83 0.33
84 0.26
85 0.23
86 0.24
87 0.31
88 0.24
89 0.23
90 0.29
91 0.35
92 0.4
93 0.47