Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T522

Protein Details
Accession A0A0L0T522   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-30LLAGQKKASTYKKKERKEKQIVNLEVRFHydrophilic
NLS Segment(s)
PositionSequence
14-21KKKERKEK
35-61RNDRPPRGDRPPRGDRPPRTDRPARGG
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MVLLAGQKKASTYKKKERKEKQIVNLEVRFNEEPRNDRPPRGDRPPRGDRPPRTDRPARGGAQQGARAPALGPPPVAKSVNIQRQVGVSRPLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.85
4 0.88
5 0.9
6 0.91
7 0.9
8 0.89
9 0.89
10 0.85
11 0.82
12 0.75
13 0.66
14 0.55
15 0.5
16 0.41
17 0.32
18 0.31
19 0.26
20 0.26
21 0.28
22 0.37
23 0.34
24 0.35
25 0.4
26 0.42
27 0.47
28 0.53
29 0.58
30 0.54
31 0.61
32 0.68
33 0.68
34 0.69
35 0.71
36 0.67
37 0.66
38 0.7
39 0.67
40 0.65
41 0.65
42 0.6
43 0.58
44 0.59
45 0.52
46 0.46
47 0.45
48 0.42
49 0.39
50 0.39
51 0.33
52 0.28
53 0.26
54 0.22
55 0.18
56 0.17
57 0.16
58 0.14
59 0.13
60 0.13
61 0.16
62 0.2
63 0.2
64 0.18
65 0.23
66 0.32
67 0.4
68 0.44
69 0.41
70 0.39
71 0.41
72 0.44
73 0.41