Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0STF6

Protein Details
Accession A0A0L0STF6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-118LGALGRKKPAKKDPPKPVRAPKPVPPPPBasic
NLS Segment(s)
PositionSequence
59-129PKPEPKSPVKMVTPKPPPIKKTTPPPAPPPLALGALGRKKPAKKDPPKPVRAPKPVPPPPAPATPKSPPPK
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 9.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
Pfam View protein in Pfam  
PF13646  HEAT_2  
Amino Acid Sequences MPDPPKAPTPPPPPPPRDPTPPPPPPPEPVPEPELEPPRDPTPPPGRTSQPAIAPDSPPKPEPKSPVKMVTPKPPPIKKTTPPPAPPPLALGALGRKKPAKKDPPKPVRAPKPVPPPPAPATPKSPPPKPATPVLPSVPVTPHTPRVEDQVVWSMLRRRPIVGANHTAVKPTEYHMDMRRRASGETSVSGDSPGDELQHKLHRVMSLSWFPGLGGRGVTVDNVVSVLGECVRSGASARARVEATKMLAYVHTVFQRDIREPATMLLAPQLEALANDPDWHVRAQIAAALPRFGYYHQDVVMGLVARLGDVHPAVRQAAMQSLAFYHIESRDQLETVMIRLGLLSAPSGETGGSRAAGGKGGGGGGGKYRSILDDLYDQYVRREQEKVAKSVAAVQQWLTGAQYRYTKRLSSVGGGVVEGEVGEYESGAESRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.76
4 0.76
5 0.75
6 0.75
7 0.75
8 0.77
9 0.76
10 0.76
11 0.73
12 0.69
13 0.66
14 0.63
15 0.58
16 0.53
17 0.51
18 0.45
19 0.44
20 0.46
21 0.48
22 0.45
23 0.42
24 0.42
25 0.4
26 0.43
27 0.4
28 0.42
29 0.45
30 0.47
31 0.48
32 0.49
33 0.51
34 0.51
35 0.57
36 0.53
37 0.48
38 0.46
39 0.48
40 0.46
41 0.43
42 0.46
43 0.43
44 0.42
45 0.39
46 0.41
47 0.42
48 0.45
49 0.5
50 0.53
51 0.57
52 0.59
53 0.64
54 0.66
55 0.69
56 0.69
57 0.71
58 0.69
59 0.7
60 0.74
61 0.73
62 0.7
63 0.69
64 0.73
65 0.7
66 0.72
67 0.74
68 0.74
69 0.72
70 0.75
71 0.74
72 0.69
73 0.62
74 0.54
75 0.46
76 0.37
77 0.32
78 0.26
79 0.25
80 0.28
81 0.28
82 0.29
83 0.32
84 0.35
85 0.43
86 0.52
87 0.56
88 0.6
89 0.69
90 0.77
91 0.83
92 0.87
93 0.89
94 0.89
95 0.88
96 0.87
97 0.83
98 0.8
99 0.8
100 0.79
101 0.77
102 0.7
103 0.66
104 0.6
105 0.63
106 0.59
107 0.52
108 0.51
109 0.48
110 0.53
111 0.53
112 0.53
113 0.51
114 0.54
115 0.57
116 0.53
117 0.56
118 0.52
119 0.49
120 0.49
121 0.44
122 0.4
123 0.34
124 0.33
125 0.28
126 0.24
127 0.24
128 0.22
129 0.28
130 0.26
131 0.27
132 0.26
133 0.31
134 0.31
135 0.27
136 0.27
137 0.25
138 0.25
139 0.22
140 0.24
141 0.24
142 0.24
143 0.29
144 0.27
145 0.22
146 0.24
147 0.29
148 0.34
149 0.33
150 0.36
151 0.32
152 0.36
153 0.35
154 0.33
155 0.28
156 0.22
157 0.17
158 0.14
159 0.16
160 0.14
161 0.17
162 0.23
163 0.31
164 0.34
165 0.36
166 0.38
167 0.35
168 0.34
169 0.33
170 0.29
171 0.23
172 0.21
173 0.21
174 0.17
175 0.16
176 0.16
177 0.14
178 0.1
179 0.09
180 0.08
181 0.07
182 0.07
183 0.08
184 0.1
185 0.15
186 0.15
187 0.15
188 0.17
189 0.17
190 0.18
191 0.19
192 0.2
193 0.19
194 0.19
195 0.18
196 0.16
197 0.14
198 0.14
199 0.13
200 0.09
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.05
207 0.05
208 0.04
209 0.04
210 0.04
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.05
221 0.09
222 0.11
223 0.16
224 0.17
225 0.19
226 0.19
227 0.19
228 0.2
229 0.18
230 0.17
231 0.13
232 0.12
233 0.1
234 0.1
235 0.11
236 0.11
237 0.12
238 0.12
239 0.13
240 0.13
241 0.16
242 0.18
243 0.18
244 0.19
245 0.18
246 0.17
247 0.16
248 0.16
249 0.16
250 0.13
251 0.12
252 0.12
253 0.1
254 0.1
255 0.09
256 0.09
257 0.06
258 0.06
259 0.08
260 0.06
261 0.06
262 0.07
263 0.07
264 0.08
265 0.09
266 0.09
267 0.08
268 0.07
269 0.07
270 0.07
271 0.09
272 0.1
273 0.12
274 0.12
275 0.12
276 0.12
277 0.12
278 0.12
279 0.1
280 0.14
281 0.13
282 0.15
283 0.15
284 0.16
285 0.15
286 0.15
287 0.17
288 0.12
289 0.1
290 0.08
291 0.08
292 0.07
293 0.07
294 0.07
295 0.06
296 0.06
297 0.07
298 0.07
299 0.08
300 0.09
301 0.09
302 0.09
303 0.08
304 0.1
305 0.11
306 0.11
307 0.1
308 0.1
309 0.12
310 0.12
311 0.11
312 0.11
313 0.11
314 0.12
315 0.13
316 0.16
317 0.15
318 0.15
319 0.15
320 0.14
321 0.13
322 0.13
323 0.13
324 0.1
325 0.08
326 0.08
327 0.08
328 0.07
329 0.07
330 0.06
331 0.05
332 0.06
333 0.06
334 0.06
335 0.06
336 0.06
337 0.07
338 0.08
339 0.07
340 0.07
341 0.09
342 0.09
343 0.1
344 0.1
345 0.09
346 0.08
347 0.08
348 0.08
349 0.07
350 0.07
351 0.09
352 0.1
353 0.1
354 0.1
355 0.11
356 0.12
357 0.13
358 0.13
359 0.12
360 0.16
361 0.19
362 0.23
363 0.24
364 0.23
365 0.24
366 0.29
367 0.28
368 0.26
369 0.26
370 0.26
371 0.34
372 0.4
373 0.41
374 0.39
375 0.38
376 0.36
377 0.41
378 0.41
379 0.34
380 0.29
381 0.26
382 0.25
383 0.25
384 0.25
385 0.18
386 0.19
387 0.18
388 0.22
389 0.29
390 0.3
391 0.35
392 0.39
393 0.39
394 0.37
395 0.42
396 0.4
397 0.37
398 0.37
399 0.35
400 0.32
401 0.3
402 0.27
403 0.21
404 0.17
405 0.12
406 0.09
407 0.05
408 0.05
409 0.05
410 0.04
411 0.05
412 0.06