Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T9J6

Protein Details
Accession A0A0L0T9J6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
188-213VVVVTKQHPRPFRRSRRPRRPPSQWSHydrophilic
NLS Segment(s)
PositionSequence
196-209PRPFRRSRRPRRPP
Subcellular Location(s) extr 18, mito 4, cyto 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001153  Barwin_dom  
IPR036908  RlpA-like_sf  
Gene Ontology GO:0042742  P:defense response to bacterium  
GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF00967  Barwin  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MSHLVSQLVLATALLAAFASAAPSSPVKSGTARLASFGDVSPALVKRGLASGRGEGTYYDVGLGACESTNSNSELVVALNAPDFGPAWPPRSSAACTSCLAISSPENPSAGTVVVRIVDKCPGCKAGDLDMSPAVFTKFFPEGKGRFNIEWKAVQCGGGSPAPAPAPAPVVVAKPAPQPTQAPAPPAVVVVTKQHPRPFRRSRRPRRPPSQWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.07
10 0.08
11 0.09
12 0.11
13 0.12
14 0.13
15 0.15
16 0.18
17 0.23
18 0.28
19 0.26
20 0.27
21 0.27
22 0.26
23 0.25
24 0.22
25 0.18
26 0.12
27 0.12
28 0.13
29 0.12
30 0.13
31 0.12
32 0.12
33 0.11
34 0.15
35 0.15
36 0.15
37 0.16
38 0.18
39 0.19
40 0.19
41 0.19
42 0.14
43 0.17
44 0.14
45 0.12
46 0.1
47 0.09
48 0.08
49 0.08
50 0.08
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.08
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.08
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.09
73 0.11
74 0.14
75 0.14
76 0.15
77 0.16
78 0.18
79 0.2
80 0.2
81 0.21
82 0.21
83 0.21
84 0.21
85 0.19
86 0.17
87 0.16
88 0.12
89 0.1
90 0.1
91 0.11
92 0.11
93 0.11
94 0.1
95 0.1
96 0.1
97 0.09
98 0.07
99 0.06
100 0.05
101 0.06
102 0.06
103 0.07
104 0.07
105 0.11
106 0.11
107 0.12
108 0.13
109 0.15
110 0.15
111 0.16
112 0.17
113 0.16
114 0.2
115 0.19
116 0.19
117 0.18
118 0.17
119 0.15
120 0.14
121 0.11
122 0.07
123 0.07
124 0.09
125 0.12
126 0.12
127 0.14
128 0.2
129 0.22
130 0.26
131 0.3
132 0.3
133 0.28
134 0.32
135 0.33
136 0.3
137 0.33
138 0.29
139 0.3
140 0.27
141 0.26
142 0.22
143 0.2
144 0.2
145 0.16
146 0.16
147 0.11
148 0.12
149 0.12
150 0.12
151 0.11
152 0.09
153 0.11
154 0.1
155 0.12
156 0.11
157 0.12
158 0.13
159 0.14
160 0.15
161 0.18
162 0.22
163 0.22
164 0.24
165 0.24
166 0.26
167 0.35
168 0.35
169 0.33
170 0.3
171 0.3
172 0.28
173 0.26
174 0.24
175 0.15
176 0.15
177 0.17
178 0.22
179 0.26
180 0.32
181 0.38
182 0.46
183 0.51
184 0.61
185 0.67
186 0.71
187 0.77
188 0.84
189 0.88
190 0.91
191 0.96
192 0.96
193 0.96